SecReT6
Protein ID: 336124011
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03039
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1529573..1530103 [+]
Producthypothetical protein
NoteTssD
UniProt IDF7YHY4
KEGG IDvan:VAA_03039
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.70E-30, Aligned region: 5..149
Protein Sequence: 176 a.a.     [Download]
>gi|336124011|ref|YP_004566059.1| hypothetical protein VAA_03039 [Vibrio anguillarum 775]
MASIYMRVSGLQVEGAATIGQLETAEGKNDGWFAINSYSWGGARNVAMDIGNGTNADSGMVGVSEVSVTK
EVDGASEDLLSYLFNPGKDGKTVEVAFTKPSNDGQGADVYFQVKLEKARLVSYNVSGTDGSQPYESLSLS
YTSISQKHHYEKEGGELQSGGVVTYDLPTGKMTSGK
 
Nucleotide Sequence: 531 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1529573-1530103 Vibrio anguillarum 775 chromosome I, complete sequence
ATGGCAAGTATTTACATGCGTGTAAGCGGTCTTCAAGTTGAGGGCGCAGCGACTATCGGTCAGCTAGAAA
CGGCTGAAGGTAAAAATGACGGTTGGTTTGCAATCAACTCTTACTCTTGGGGTGGCGCTCGTAACGTTGC
TATGGACATCGGTAACGGCACCAATGCGGATTCAGGCATGGTTGGCGTAAGCGAAGTTAGCGTAACTAAA
GAAGTCGATGGTGCTTCTGAAGACCTACTGTCTTATTTATTCAACCCAGGTAAAGACGGTAAAACTGTTG
AGGTTGCATTTACTAAGCCTTCTAACGATGGTCAAGGTGCAGACGTTTACTTCCAAGTTAAGCTAGAAAA
AGCACGTTTAGTTTCTTACAACGTGAGCGGGACTGACGGATCTCAACCGTACGAGAGCCTATCTCTTTCT
TACACTTCTATTTCTCAGAAGCATCACTATGAGAAAGAAGGTGGTGAACTACAAAGCGGTGGTGTTGTGA
CTTACGACCTACCGACCGGGAAAATGACTTCTGGTAAGTAA
 Primer design