SecReT6
Protein ID: 336124012
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03038
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1530173..1530682 [+]
Producthypothetical protein
NoteTssB
UniProt IDF7YHY5
KEGG IDvan:VAA_03038
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-56, Aligned region: 7..162
Protein Sequence: 169 a.a.     [Download]
>gi|336124012|ref|YP_004566060.1| hypothetical protein VAA_03038 [Vibrio anguillarum 775]
MALNSQHKRVSKNRVSITYDVETNGAVETKELPFVVGVIGDFSGHKPESEKVDLEEREFTGIDKDNFDTV
MGQIHPRLSYKVDNKLANDDSQFEVNLSFRSMKDFHPENLVDQIEPLKQLVETRNQLKVLLSKADRSRDL
ERLLKEVLQSADAINGLAQELGLSREGAE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1530173-1530682 Vibrio anguillarum 775 chromosome I, complete sequence
ATGGCATTGAACTCACAACATAAGCGCGTTAGTAAGAACCGTGTCAGCATCACCTATGACGTTGAAACGA
ATGGCGCCGTAGAGACGAAAGAGCTGCCGTTTGTTGTTGGCGTCATTGGCGACTTTTCAGGACACAAACC
AGAATCAGAAAAAGTTGATTTAGAAGAGCGAGAGTTCACGGGTATCGATAAAGACAACTTCGATACAGTG
ATGGGGCAAATTCACCCGCGTCTTTCGTACAAGGTTGATAACAAGCTTGCTAATGATGATAGCCAGTTTG
AAGTGAACTTGAGCTTCCGTTCGATGAAAGATTTCCACCCAGAGAACTTAGTTGATCAAATTGAGCCGCT
TAAGCAGTTGGTTGAAACACGTAACCAGCTAAAAGTACTCTTAAGCAAAGCCGATCGTTCGAGAGATCTT
GAGCGTCTACTGAAAGAAGTTCTGCAAAGCGCAGATGCCATCAATGGTTTAGCTCAAGAACTAGGTTTGA
GCAGAGAGGGAGCGGAATAA
 Primer design