SecReT6
Protein ID: 336124013
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03037
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1530682..1532163 [+]
Producthypothetical protein
NoteTssC
UniProt IDF7YHY6
KEGG IDvan:VAA_03037
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-163, Aligned region: 63..492
Protein Sequence: 493 a.a.     [Download]
>gi|336124013|ref|YP_004566061.1| hypothetical protein VAA_03037 [Vibrio anguillarum 775]
MSVEQQAVQGTTTEAEAKQSFLDRAINATAQTPVDTTKELLSVMASQALEGTVTWDKNLTLTIEKAISAL
DSKISEQLSTVMQNDEFQKMEGSWLGLQKLVKNSELGSDLKIKVADYTKDELLEQFEDAPAIDRSRFFNM
VYQEEFGTAGGQPYGALLGDYGFGYGDEDVALLRYMAEVASASHAPFVAAANASMFDFKAFSSFSEGKPV
AAGFDSPAYASWNAFRESDDSRYVALTLPKTMARLPYGAATVPVKSFAFEELQIRDNGQQIVSSDCDFVW
SNAAYEFGLLMTQAYTKYGWCTAIRGTENGGKVENLPNFTHYSEAGELLQQCPTEVNLTDEREKELSDLG
FLPLVHYKSTNYAVFMGAQTAHKPKTYTDPDATANAAISARLPYTMASSRIAQYLKIMGRDRIGSNLAPN
DVEKELNSWINQYVNPNAIGNDAKATHPLVEAKVTVEEQAGRPGAYSAVAYLRPWLQMEELTTSLRMVAN
IPG
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1530682-1532163 Vibrio anguillarum 775 chromosome I, complete sequence
ATGTCTGTAGAACAACAAGCAGTACAAGGTACTACTACTGAAGCAGAAGCAAAGCAGAGCTTTCTTGACC
GAGCGATCAACGCGACAGCACAAACACCAGTAGATACGACAAAAGAGCTATTGAGCGTCATGGCTTCTCA
AGCACTGGAAGGTACAGTGACTTGGGATAAGAACCTAACGTTGACGATTGAAAAAGCAATCAGCGCGCTA
GACAGCAAAATCTCTGAGCAGTTGTCAACGGTGATGCAAAACGATGAGTTCCAAAAAATGGAAGGTTCAT
GGCTAGGTTTGCAAAAGCTTGTAAAAAACAGCGAGCTAGGATCAGATCTGAAAATCAAAGTGGCGGATTA
CACCAAAGACGAATTGCTAGAGCAGTTTGAAGATGCACCAGCGATCGATCGCAGCCGTTTCTTCAATATG
GTTTATCAAGAAGAATTTGGAACAGCGGGCGGTCAGCCATACGGTGCATTGCTAGGTGACTACGGATTCG
GTTACGGTGATGAAGACGTTGCCCTGTTGCGTTACATGGCTGAAGTCGCTTCTGCATCTCACGCACCTTT
CGTCGCTGCAGCGAATGCAAGTATGTTCGACTTCAAGGCATTCAGTAGCTTTTCTGAAGGCAAACCAGTT
GCAGCAGGCTTTGATTCGCCAGCATATGCAAGCTGGAATGCATTCCGTGAAAGCGATGACTCGCGCTACG
TTGCTCTGACTCTACCGAAAACGATGGCTCGCCTTCCTTACGGTGCAGCAACCGTTCCAGTTAAATCATT
TGCATTTGAAGAACTTCAAATTCGGGACAACGGTCAGCAAATTGTGTCTTCAGACTGCGATTTTGTTTGG
AGCAATGCGGCGTATGAGTTTGGTCTTCTGATGACTCAAGCATATACCAAGTACGGTTGGTGCACGGCGA
TCCGAGGTACTGAGAACGGCGGTAAAGTAGAGAACCTGCCAAACTTCACTCACTACTCTGAGGCCGGTGA
ATTGCTACAGCAATGCCCGACAGAAGTTAACCTAACGGATGAGCGTGAGAAAGAGCTGAGTGATCTTGGC
TTCTTGCCACTGGTTCACTACAAAAGCACCAACTACGCAGTGTTTATGGGTGCTCAGACTGCGCATAAAC
CAAAAACGTACACAGATCCAGATGCAACGGCAAACGCGGCAATTTCAGCGCGTCTGCCATACACAATGGC
AAGCAGCCGAATCGCACAGTACCTAAAAATCATGGGCCGTGATCGTATTGGTTCAAACCTAGCTCCAAAT
GACGTTGAGAAAGAGCTGAACTCTTGGATTAATCAATACGTTAACCCAAATGCGATTGGTAACGATGCGA
AAGCAACACATCCATTGGTTGAAGCGAAAGTGACGGTAGAAGAGCAAGCTGGACGCCCAGGTGCTTACTC
TGCAGTGGCTTACTTACGCCCTTGGCTGCAAATGGAAGAGCTAACCACTTCACTACGAATGGTTGCGAAC
ATTCCTGGCTAA
 Primer design