SecReT6
Protein ID: 336124015
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03035
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1533562..1533978 [+]
Producthypothetical protein
NoteTssE
UniProt IDF7YHY8
KEGG IDvan:VAA_03035
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-11, Aligned region: 16..112
Protein Sequence: 138 a.a.     [Download]
>gi|336124015|ref|YP_004566063.1| hypothetical protein VAA_03035 [Vibrio anguillarum 775]
MSLMAKLTQSWNDDIDSVRDAIVDNVCDLISSRAPLCSEMLLSEKGTIAELGMRNMARAQSKNNTSDIVA
EIEVLVRNFEPRLSQVEIDVQEGELGSNQLSFRLSAVVHSELGDEAIVLDSFLDLSSNKLDVRKSNFV
 
Nucleotide Sequence: 417 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1533562-1533978 Vibrio anguillarum 775 chromosome I, complete sequence
ATGAGCTTAATGGCTAAGTTAACCCAAAGCTGGAATGACGATATCGATAGTGTTCGAGATGCAATTGTTG
ATAACGTCTGTGATCTTATTTCCAGCCGAGCACCTCTGTGTTCAGAGATGCTTTTATCGGAAAAAGGAAC
GATTGCCGAGCTCGGTATGCGCAACATGGCTCGCGCTCAAAGTAAAAACAACACCAGTGACATTGTCGCA
GAAATTGAAGTGCTGGTCCGAAACTTCGAACCTCGCCTGAGCCAGGTAGAGATTGATGTTCAAGAAGGGG
AACTGGGTAGCAACCAATTGAGCTTTCGCCTTTCCGCCGTGGTGCATTCAGAGCTTGGTGATGAAGCGAT
CGTACTGGATTCTTTTTTGGATTTGAGCAGCAACAAACTAGATGTAAGGAAGTCGAATTTTGTCTGA
 Primer design