SecReT6
Protein ID: 336124016
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03034
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1533971..1534567 [+]
Producthypothetical protein
NoteTssF
UniProt IDF7YHY9
KEGG IDvan:VAA_03034
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.50E-60, Aligned region: 5..189
Protein Sequence: 198 a.a.     [Download]
>gi|336124016|ref|YP_004566064.1| hypothetical protein VAA_03034 [Vibrio anguillarum 775]
MSDSLLSYFEQELRFIRNETSQFAERHPGTARALGMRKDSIDDPQIARLIESVALMNGKLQQRLDESYPE
LTESLVNLLFPHYLRPIPSYSMLDFAIFEEANAKHSILKGTEFDVASESGEPVVFRTSENIALLPIQVAS
AEVLFAPFELAKPVGAENAKAMLELTIEATDSGIELRDLDIDQLKLHLKVKSLCIAFV
 
Nucleotide Sequence: 597 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1533971-1534567 Vibrio anguillarum 775 chromosome I, complete sequence
TTGTCTGATTCATTGCTTTCCTATTTTGAACAGGAACTGCGCTTTATTCGCAATGAAACCTCTCAGTTCG
CGGAACGTCATCCGGGGACGGCTCGTGCATTGGGAATGCGTAAAGACAGTATTGATGATCCTCAGATCGC
GCGTTTGATTGAAAGTGTTGCCTTGATGAACGGCAAACTTCAGCAGCGTTTGGATGAGTCTTACCCAGAG
CTGACAGAAAGCTTGGTGAACTTGTTGTTCCCGCATTATCTGAGGCCAATACCGTCATACAGCATGTTGG
ACTTCGCTATTTTTGAAGAAGCGAATGCAAAGCACAGTATTCTTAAAGGCACTGAGTTCGATGTCGCGAG
CGAATCTGGCGAGCCAGTGGTGTTTCGTACTTCCGAAAATATAGCGCTGCTTCCAATTCAAGTTGCTTCG
GCTGAAGTGCTGTTTGCGCCATTTGAACTGGCTAAGCCTGTGGGTGCAGAGAACGCAAAAGCGATGCTGG
AGCTGACGATTGAGGCAACCGATAGCGGTATCGAGTTGCGTGATCTAGATATTGACCAGTTGAAACTGCA
TCTCAAGGTGAAGTCACTTTGCATTGCGTTTGTATGA
 Primer design