SecReT6
Protein ID: 336124017
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03032
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1535732..1536715 [+]
Producthypothetical protein
NoteTssG
UniProt IDF7YHZ0
KEGG IDvan:VAA_03032
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-54, Aligned region: 33..311
Protein Sequence: 327 a.a.     [Download]
>gi|336124017|ref|YP_004566065.1| hypothetical protein VAA_03032 [Vibrio anguillarum 775]
MQEFVVSRFAHGAFEGQLEKAWQIFKHQAHLKGQRPEVRFSAEILPAYYQAEVSMVTSEREGEFTVKTSL
AALSGNSGSMPRAMYGDALKARFELGDEAPLDFFDMFNNRYYRLYCETKQKHELTYQIEEEAFHWNRDRQ
SITEMLSSLAGQTGDKAPMPESHLVQYTGLLGLKLTCPLALKSMLEDYFESEFEVERSGLEYLPLTECSL
TQIGQAGNNHQLGVGALVGMSTPMTGQKLSIKICPQDYQHYLKIRSDKEMVLALDHMVRSYMGVNTKYAL
YMKVNSQYLPRVKLSGSHQKALRIGQSAWMSHQSDRQQFVEMPLTKS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1535732-1536715 Vibrio anguillarum 775 chromosome I, complete sequence
GTGCAAGAGTTTGTTGTAAGCCGTTTCGCTCATGGTGCGTTTGAAGGTCAGCTAGAAAAAGCGTGGCAGA
TCTTCAAGCATCAGGCTCATTTAAAGGGGCAGCGACCTGAAGTGAGGTTCAGTGCGGAAATTCTCCCAGC
TTACTATCAAGCAGAAGTCTCTATGGTTACTTCTGAGCGAGAGGGTGAATTTACGGTAAAGACATCATTG
GCGGCTTTGTCTGGCAACTCTGGTTCGATGCCAAGAGCGATGTATGGCGATGCACTAAAAGCGCGTTTTG
AACTTGGTGATGAAGCACCACTCGACTTTTTCGACATGTTTAATAACCGTTACTACCGCTTGTACTGCGA
AACAAAGCAAAAGCATGAGCTGACGTATCAGATTGAGGAAGAGGCGTTTCATTGGAATCGTGACCGTCAA
TCTATCACTGAAATGCTTTCCAGTTTGGCGGGACAGACTGGAGATAAGGCACCAATGCCGGAATCTCACT
TGGTGCAATACACTGGCTTATTAGGGTTGAAGTTAACCTGTCCATTGGCGCTTAAGTCGATGCTAGAAGA
TTACTTTGAGTCGGAGTTTGAGGTTGAACGCAGTGGCCTAGAGTATTTGCCTCTCACGGAGTGTTCGTTA
ACTCAAATTGGCCAAGCCGGAAACAATCATCAATTGGGAGTGGGCGCGTTGGTCGGGATGTCGACGCCAA
TGACGGGGCAGAAACTCAGCATAAAAATTTGCCCTCAAGACTATCAGCATTACTTAAAAATACGCAGTGA
CAAAGAGATGGTTCTTGCGCTGGACCATATGGTTAGAAGCTATATGGGAGTGAATACCAAGTATGCACTC
TATATGAAGGTAAATAGCCAGTATCTGCCGAGAGTGAAGCTATCAGGCAGTCACCAAAAAGCGTTACGAA
TTGGCCAATCCGCGTGGATGAGTCATCAATCAGATCGTCAACAGTTTGTTGAAATGCCACTGACGAAAAG
TTAG
 Primer design