SecReT6
Protein ID: 336124018
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03031
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1536724..1539330 [+]
ProductClpV protein
NoteTssH
UniProt IDF7YHZ1
KEGG IDvan:VAA_03031
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 219..240
AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 602..767
AAA [PF00004], Evalue: 2.50E-22, Aligned region: 219..351
AAA [PF00004], Evalue: 2.50E-22, Aligned region: 608..729
AAA_5 [PF07728], Evalue: 1.50E-16, Aligned region: 219..356
AAA_5 [PF07728], Evalue: 1.50E-16, Aligned region: 607..728
ClpB_D2-small [PF10431], Evalue: 3.50E-13, Aligned region: 452..492
ClpB_D2-small [PF10431], Evalue: 3.50E-13, Aligned region: 773..847
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 42..58
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 197..242
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 256..297
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 477..513
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 599..626
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 674..700
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 744..850
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 214..303
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 606..694
Zeta_toxin [PF06414], Evalue: 5.00E-07, Aligned region: 214..241
Zeta_toxin [PF06414], Evalue: 5.00E-07, Aligned region: 600..648
AAA_14 [PF13173], Evalue: 1.10E-05, Aligned region: 219..349
AAA_14 [PF13173], Evalue: 1.10E-05, Aligned region: 606..777
IstB_IS21 [PF01695], Evalue: 2.00E-05, Aligned region: 214..244
IstB_IS21 [PF01695], Evalue: 2.00E-05, Aligned region: 607..625
Sigma54_activat [PF00158], Evalue: 3.50E-05, Aligned region: 216..298
Sigma54_activat [PF00158], Evalue: 3.50E-05, Aligned region: 607..726
AAA_18 [PF13238], Evalue: 0.00019, Aligned region: 219..282
AAA_18 [PF13238], Evalue: 0.00019, Aligned region: 610..637
AAA_17 [PF13207], Evalue: 0.00036, Aligned region: 220..269
AAA_17 [PF13207], Evalue: 0.00036, Aligned region: 607..642
Mg_chelatase [PF01078], Evalue: 0.00066, Aligned region: 219..240
Mg_chelatase [PF01078], Evalue: 0.00066, Aligned region: 607..706
AAA_23 [PF13476], Evalue: 0.00075, Aligned region: 219..235
AAA_23 [PF13476], Evalue: 0.00075, Aligned region: 420..478
AAA_23 [PF13476], Evalue: 0.00075, Aligned region: 605..643
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 212..235
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 605..633
RNA_helicase [PF00910], Evalue: 0.0018, Aligned region: 220..242
RNA_helicase [PF00910], Evalue: 0.0018, Aligned region: 608..628
RNA_helicase [PF00910], Evalue: 0.0018, Aligned region: 709..725
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 216..242
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 605..629
MobB [PF03205], Evalue: 0.0028, Aligned region: 220..247
MobB [PF03205], Evalue: 0.0028, Aligned region: 606..630
AAA_33 [PF13671], Evalue: 0.0044, Aligned region: 219..238
AAA_33 [PF13671], Evalue: 0.0044, Aligned region: 606..621
DUF258 [PF03193], Evalue: 0.0053, Aligned region: 143..162
DUF258 [PF03193], Evalue: 0.0053, Aligned region: 214..239
DUF258 [PF03193], Evalue: 0.0053, Aligned region: 607..619
DUF2075 [PF09848], Evalue: 0.0053, Aligned region: 221..320
DUF2075 [PF09848], Evalue: 0.0053, Aligned region: 606..632
SRP54 [PF00448], Evalue: 0.007, Aligned region: 219..249
SRP54 [PF00448], Evalue: 0.007, Aligned region: 422..440
SRP54 [PF00448], Evalue: 0.007, Aligned region: 606..628
NACHT [PF05729], Evalue: 0.0083, Aligned region: 219..245
NACHT [PF05729], Evalue: 0.0083, Aligned region: 608..628
Protein Sequence: 868 a.a.     [Download]
>gi|336124018|ref|YP_004566066.1| ClpV protein [Vibrio anguillarum 775]
MINIELQSLVKRLNPLLKSALETAAGDCVSKGHFAIEAEHWFVQLLQQSKGWEAALQQASMAKESMLERC
NDRQMHLARGNDSSPSLSPELVELLKDAWMLASLNNQQSVVNEFHLLMVLKQRLDQSACNGVLSSWVSVL
SSEWLRSQSMVISGPSEVSSSTESMVPTGGDSATPALDKFSQNLTEAARNGELDPITGRGDEIRKSIDIL
CRRRQNSPILVGDPGVGKTAIVEGLAQEIVNRNVPPALANVELRSLDLSLLQAGASIKGEFENRLKDVIN
EIKQSTTPIIMFIDEAHTLIGAGGTAGQNDAANILKPALARGEFRSLAATTWAEYKQYFESDAALTRRFQ
VVAVNEPNEEDAIHMLLGVKHSLEKHHGVKVMQEAIDAAVALSIRYLPERKLPDKAISLLDTACSRIGLS
QSAAPRQLEAIAEKIRYTNNEIETLHHESALWSIESVRLEEAKQRLAALEQEHQSLERSWNAERLLVEEI
IELQSGLDAELKENGSVISHEAKILLADKMAALREIQGEQPLVLPQVTEQTIAEVVALWTGIPVGNMLSQ
EVEKLMHLETRIGERVIGQTTPIAELSQAIRLSRAGLTDPRKPVGVFLMCGPSGVGKTETALALTDLLYG
GERNITTINMTEFKEEHKVSMLLGSPAGYVGYGKGGVLTEAVRKNPYSVLLLDEMEKAHPSVHDIFYQIF
DKGSISDSEGRHIDFRNTIIIMTSNAADSAVVNACENSRPDVPTLTQSIFPELQKHFKPAFLGRATIVPY
FPLNDEEMAQIATLSLNRIRKRVQSHYKASFEFHPDVIDLLVNMNDSPETGARAVEQLINRQLMPDLANQ
CIVRMSENKPVEVVTVHVEEGKFKIQIQ
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1536724-1539330 Vibrio anguillarum 775 chromosome I, complete sequence
ATGATAAATATTGAACTACAAAGCTTGGTCAAAAGGCTTAATCCGTTACTAAAAAGTGCTCTGGAAACGG
CTGCAGGAGATTGTGTAAGTAAAGGACACTTTGCGATAGAAGCTGAGCATTGGTTTGTTCAGTTGTTACA
GCAGTCCAAAGGCTGGGAAGCCGCACTGCAGCAAGCATCAATGGCGAAAGAGTCGATGTTGGAGCGTTGT
AATGACCGTCAGATGCACTTGGCTCGTGGTAATGACTCTTCACCTTCTTTGTCACCTGAATTGGTTGAGT
TGCTTAAAGATGCATGGATGCTTGCTTCATTAAATAATCAGCAATCGGTCGTAAATGAATTTCATCTGCT
GATGGTGCTGAAGCAGCGTTTGGACCAAAGCGCTTGCAACGGCGTGTTGAGCTCGTGGGTGTCAGTATTG
TCTTCTGAATGGTTACGTAGTCAGTCGATGGTGATCAGCGGACCCAGTGAAGTCTCATCGTCTACCGAGA
GCATGGTCCCAACCGGTGGTGACTCAGCGACACCAGCTTTGGACAAGTTCTCGCAAAACCTGACAGAGGC
AGCGCGTAATGGCGAGTTGGATCCTATTACAGGGCGCGGAGATGAAATTCGCAAATCCATTGATATTTTG
TGCCGCCGCCGTCAAAACAGCCCGATCCTCGTTGGTGACCCAGGTGTAGGTAAAACGGCCATTGTTGAAG
GTCTTGCCCAAGAAATCGTGAATAGAAATGTCCCACCTGCGCTTGCAAACGTTGAGCTGCGCAGCCTTGA
TTTGTCCCTTTTGCAAGCGGGCGCGAGCATCAAAGGTGAGTTTGAAAACCGCCTTAAAGATGTAATAAAT
GAGATCAAGCAGTCAACCACGCCGATCATCATGTTTATTGATGAAGCACATACGCTGATCGGGGCGGGTG
GCACAGCGGGCCAGAATGATGCGGCGAATATTCTGAAACCAGCGCTTGCGCGTGGCGAGTTTCGTTCACT
TGCGGCGACCACATGGGCGGAATACAAACAGTACTTTGAATCGGATGCCGCGTTGACTCGTCGCTTTCAA
GTTGTTGCGGTTAATGAACCTAATGAAGAAGACGCTATCCACATGCTTCTCGGCGTGAAGCACAGCCTTG
AAAAGCACCATGGTGTTAAAGTCATGCAAGAAGCCATTGATGCCGCAGTCGCTCTCTCTATTCGTTACCT
TCCTGAGCGTAAGTTACCTGATAAAGCAATTAGCCTGTTAGATACAGCGTGTTCACGCATTGGATTGAGC
CAAAGTGCGGCACCTAGACAGTTGGAAGCCATTGCAGAAAAAATCCGCTACACCAACAACGAGATCGAAA
CGTTACATCATGAGTCGGCATTGTGGTCGATTGAAAGCGTACGCTTGGAAGAAGCAAAACAGCGATTGGC
GGCTTTAGAACAAGAGCATCAGTCACTTGAGCGCTCTTGGAACGCAGAGCGCCTCTTGGTGGAAGAGATC
ATTGAGTTGCAGTCTGGCTTAGACGCTGAGCTAAAAGAAAATGGCTCGGTGATATCGCATGAAGCGAAAA
TCCTGCTAGCAGACAAAATGGCAGCCCTGCGTGAGATCCAGGGTGAGCAGCCATTAGTATTGCCACAGGT
AACAGAGCAAACCATCGCTGAAGTGGTGGCGCTATGGACGGGTATTCCAGTAGGCAACATGCTTAGCCAA
GAAGTTGAGAAGTTGATGCACCTAGAGACTCGTATCGGTGAGCGAGTGATTGGTCAGACAACGCCGATAG
CAGAGCTTTCACAAGCAATTCGATTGTCGCGCGCAGGTTTAACCGACCCACGCAAACCTGTTGGGGTATT
CCTGATGTGTGGTCCAAGTGGTGTGGGTAAAACCGAAACTGCATTGGCACTTACCGACTTGCTATACGGT
GGCGAGCGAAATATCACCACCATCAACATGACAGAATTTAAAGAAGAGCACAAAGTGTCGATGCTTTTAG
GCTCTCCTGCGGGTTATGTTGGCTACGGTAAAGGCGGTGTCTTAACAGAAGCGGTACGTAAGAACCCATA
TTCTGTACTGCTGCTGGATGAAATGGAAAAAGCCCACCCTAGTGTGCACGATATCTTCTATCAAATCTTT
GATAAAGGCTCGATCTCGGACAGTGAAGGTCGACACATCGATTTTCGTAATACGATCATCATCATGACAT
CAAACGCGGCAGACAGCGCTGTTGTTAATGCATGTGAAAATAGTCGACCGGATGTTCCGACGCTGACTCA
GTCTATTTTCCCTGAGCTGCAAAAACACTTTAAACCAGCATTTCTTGGCCGTGCGACCATCGTGCCTTAC
TTCCCTTTGAACGATGAAGAAATGGCGCAAATTGCAACCTTGTCTCTGAACCGCATTCGCAAGCGCGTTC
AATCCCACTACAAAGCAAGTTTCGAATTTCACCCTGATGTGATTGATCTGCTGGTCAATATGAATGATTC
ACCAGAAACAGGAGCTCGTGCCGTTGAGCAACTGATCAATCGTCAACTTATGCCGGATTTAGCGAATCAG
TGCATTGTCCGCATGAGCGAGAACAAGCCAGTAGAAGTGGTCACTGTTCACGTTGAAGAAGGCAAATTTA
AGATTCAGATTCAATAG
 Primer design