SecReT6
Protein ID: 336124023
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03026
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1544670..1545641 [+]
Producthypothetical protein
NoteFha
UniProt IDF7YHZ6
KEGG IDvan:VAA_03026
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-12, Aligned region: 38..105
Protein Sequence: 323 a.a.     [Download]
>gi|336124023|ref|YP_004566071.1| hypothetical protein VAA_03026 [Vibrio anguillarum 775]
MNLLKVSQMPLSIRIISSPDGESIAQWNQAFPDDGGDIGRAFGATLQLNDASREISSTHAMIRKTSRGYQ
IMDNSTNGLYINGSDVPLGKGNQSTLSDGDVLDIGRYRLLVSCFFPETAKAQIQQPHSDSCRLGDDPFST
ESTPFIQSIPEVDEAPGFTISTTDVVGDDPFASDASVKQELAPHFNLDFQTAEDDPLKDSDFRTSFPNHE
VMATSSFAQEESPLNHSQFAITEFKNHGQRLQERTDKALEMALARLLSDISPNAMESMFDDLSGNGFWSR
KPKYWDMYKRYFNRQVENRDWQIKFQAYFRDAMRMQKNFEGDQ
 
Nucleotide Sequence: 972 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1544670-1545641 Vibrio anguillarum 775 chromosome I, complete sequence
TTGAATTTATTGAAGGTCAGTCAAATGCCTCTATCGATTAGAATTATTAGCTCTCCAGATGGTGAAAGCA
TCGCCCAATGGAATCAAGCATTTCCAGACGATGGCGGAGATATCGGGCGTGCGTTTGGCGCGACGCTACA
ACTTAATGACGCAAGTCGTGAGATTTCAAGTACCCATGCAATGATTCGTAAGACCTCGCGTGGATACCAA
ATCATGGACAACAGCACCAATGGCCTTTACATCAATGGATCTGATGTGCCTTTGGGCAAGGGTAACCAAT
CTACACTAAGTGATGGTGATGTTCTTGATATTGGCCGCTACCGATTGCTGGTTTCTTGTTTCTTCCCTGA
AACAGCGAAAGCGCAAATCCAGCAGCCTCACTCAGATAGTTGTCGATTAGGTGATGATCCGTTTAGTACT
GAATCAACACCTTTTATTCAAAGTATTCCTGAAGTAGATGAAGCGCCTGGGTTCACCATCTCGACGACAG
ATGTGGTGGGGGATGACCCATTTGCGAGTGATGCCTCAGTTAAGCAAGAACTAGCGCCTCACTTTAATCT
TGATTTTCAGACGGCTGAGGATGACCCACTGAAAGACAGTGATTTTCGTACGTCATTTCCAAACCATGAA
GTGATGGCGACCTCCTCTTTCGCTCAAGAAGAGTCACCACTGAACCACTCTCAGTTTGCTATCACTGAGT
TTAAGAATCATGGGCAGCGCTTACAGGAACGTACGGACAAAGCATTAGAGATGGCATTGGCAAGGTTGTT
GTCTGACATTTCACCGAATGCGATGGAGTCGATGTTTGATGATTTGTCGGGCAACGGTTTTTGGTCTCGT
AAACCGAAGTACTGGGATATGTACAAACGCTATTTCAACCGACAAGTAGAGAATCGCGATTGGCAAATTA
AGTTTCAAGCGTACTTCAGAGATGCAATGCGTATGCAAAAAAACTTCGAAGGGGATCAGTAA
 Primer design