SecReT6
Protein ID: 336124024
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03025
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1545641..1546108 [+]
Producthypothetical protein
NoteTssJ
UniProt IDF7YHZ7
KEGG IDvan:VAA_03025
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.10E-32, Aligned region: 12..144
Protein Sequence: 155 a.a.     [Download]
>gi|336124024|ref|YP_004566072.1| hypothetical protein VAA_03025 [Vibrio anguillarum 775]
MVRRLCLMCIVLIMSGCSLWSYDMVEPKLVVDIKAATNINPNVEGKPSPVELRIYQLTNNNAFEISDFIQ
VYNDDQGVLKAELAVSRQLPSILPGETRQEIIPLGSGVKYIGVIAGFADYREAKNKVIYKPLIVNSAVIS
IEIDGINLSVSGEEE
 
Nucleotide Sequence: 468 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1545641-1546108 Vibrio anguillarum 775 chromosome I, complete sequence
ATGGTACGTCGTTTATGCCTAATGTGTATCGTCCTTATTATGTCAGGGTGCAGTTTATGGAGCTATGATA
TGGTTGAGCCAAAACTGGTCGTTGATATTAAAGCTGCGACCAATATTAACCCTAATGTTGAGGGTAAGCC
TTCTCCGGTAGAGCTCCGAATTTATCAATTGACGAATAATAATGCGTTTGAAATTTCTGATTTTATTCAA
GTTTATAATGATGACCAAGGCGTTTTAAAGGCCGAGTTGGCCGTTTCTCGCCAGCTACCCAGCATTTTGC
CGGGCGAAACTCGTCAGGAAATTATCCCACTTGGTAGTGGTGTTAAGTACATCGGTGTGATTGCGGGTTT
TGCTGATTACAGAGAGGCGAAAAACAAGGTGATTTATAAGCCGCTAATTGTGAATTCAGCGGTTATCAGT
ATTGAAATTGATGGCATTAATCTGTCTGTGTCAGGGGAAGAAGAATAA
 Primer design