SecReT6
Protein ID: 336124025
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03024
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1546108..1547424 [+]
Producthypothetical protein
NoteTssK
UniProt IDF7YHZ8
KEGG IDvan:VAA_03024
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-114, Aligned region: 18..438
Protein Sequence: 438 a.a.     [Download]
>gi|336124025|ref|YP_004566073.1| hypothetical protein VAA_03024 [Vibrio anguillarum 775]
MDNNKVVWSEGMFLSPQHFQQQERYVEHFTREFAGQISPNAYGFTSLELDRSMLNIGKVSVRRAKGIFPD
GTPFEIEQALVLDVPKNTSHKKVYLALPVSRPGTIDVGEDARLRHSSQEHPVYDTSREHSDPVQLELATL
NIQLRLEGDELKDFVLISVAEISEHKSEGVVVLNQAFVPQCLQFSVSNYLTDNVADLFAQVQYRSRAIHT
RLQAESSSKSYQSLMRDYLWLQVLGAWMPKLEQWSLDGSLLTRHLYLECVSMAGQMQGLEGKMPKSFPAW
NQDALYSIFSTVFSELLVLLREVQIDNVSTLNWDKQLFVSRRLLRTLVDDRSLYNQGRFVLAVSSSIGAT
RLSEEFPRAAKLAGNSDIAGLVRNALSGVPLRHLPYAPSELKSLNDAAYFEIDTKSELWQALIKRDEAIA
LHIDERIDDLHVDFHVIR
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1546108-1547424 Vibrio anguillarum 775 chromosome I, complete sequence
ATGGATAATAATAAAGTCGTGTGGAGTGAGGGGATGTTCCTTTCCCCTCAGCACTTTCAACAGCAAGAGC
GCTATGTTGAACATTTTACTCGTGAGTTCGCCGGACAAATTAGCCCTAATGCTTATGGATTCACCTCGCT
AGAGCTTGACCGTTCGATGTTGAACATTGGTAAGGTTTCGGTGCGTCGCGCTAAAGGCATTTTCCCAGAT
GGAACACCATTTGAAATTGAGCAAGCACTCGTGCTCGATGTGCCGAAAAATACCAGTCATAAGAAAGTGT
ATCTGGCTCTTCCGGTTTCAAGACCGGGCACTATTGATGTGGGAGAAGACGCGCGTCTTAGACACTCTTC
ACAAGAACACCCCGTTTACGATACCAGCCGAGAGCACAGTGACCCGGTTCAATTAGAGCTAGCAACGTTG
AACATTCAGCTGCGTTTGGAAGGGGATGAGCTAAAAGATTTTGTGTTGATATCCGTTGCTGAAATCAGTG
AACACAAATCTGAAGGTGTTGTTGTGTTGAACCAAGCATTCGTTCCCCAATGCTTGCAGTTTTCCGTATC
TAACTACCTAACCGATAACGTTGCTGATCTATTTGCACAAGTACAATACCGTTCCCGAGCGATTCATACT
CGTTTACAAGCGGAGTCCAGCAGTAAAAGCTATCAGTCGTTGATGCGTGACTACTTGTGGCTGCAAGTAC
TGGGGGCTTGGATGCCAAAGCTTGAACAATGGAGTCTAGATGGCTCGTTGCTGACACGTCATCTTTATTT
AGAGTGTGTTTCGATGGCTGGGCAGATGCAGGGTTTAGAAGGGAAGATGCCAAAGTCTTTCCCTGCATGG
AACCAAGATGCGCTATACAGCATTTTTTCGACCGTGTTTTCTGAGTTACTGGTGTTACTGCGTGAGGTTC
AGATAGATAACGTATCAACATTGAACTGGGACAAACAGCTGTTCGTTAGCCGCCGCTTACTGCGCACACT
GGTTGATGATCGCAGCCTATACAATCAAGGCCGTTTTGTGTTGGCCGTTTCCTCGTCTATCGGTGCCACT
CGACTCAGTGAAGAGTTTCCTCGTGCTGCGAAGCTAGCAGGGAACAGTGATATTGCCGGTTTAGTGCGTA
ATGCACTTTCAGGTGTTCCTTTGCGCCATCTTCCTTATGCACCTTCTGAGTTGAAGTCTTTGAATGACGC
CGCTTACTTCGAAATCGATACTAAGTCTGAATTGTGGCAAGCGTTGATCAAACGTGATGAGGCGATCGCT
CTTCATATTGATGAAAGAATTGATGATCTCCACGTCGATTTTCATGTGATCAGGTAG
 Primer design