SecReT6
Protein ID: 336124026
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03023
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1547432..1548574 [+]
Producthypothetical protein
NoteTssL
UniProt IDF7YHZ9
KEGG IDvan:VAA_03023
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.00E-52, Aligned region: 50..249
Protein Sequence: 380 a.a.     [Download]
>gi|336124026|ref|YP_004566074.1| hypothetical protein VAA_03023 [Vibrio anguillarum 775]
MGGLFNEEPTVQIRRVTSTESAHKQHLLPPKADTSGTERLIEDLAIYGSPLLNAATELLGILVTIKRQGT
PRDINRFRQKLLYAIDAFRLRGLHLDYHPSVIEKSCFVLCAAFDEAVLYTAWGERARWENHSLLSKVFSQ
RDGGEAFFVLLDKASQQPNKLVDFIELQYVLLALGFKGRFRHEDESQLHDITARAYGLIRHYRSESPFPV
PQTPTLIEGKRPWLMISMGKTLGLACLVLASGYGFTEYWYNSRVQPLLAQFSAIDMSDVNLKKNSSDLVY
LSSDADLGRQSESLEEETGMKGKVVTQQWEIILAVFSRASDALRLSTELKQAGYESFTREMEHGVELYLH
AGDDLNTIRKLKNELNVRFGLNATIKRALK
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1547432-1548574 Vibrio anguillarum 775 chromosome I, complete sequence
ATGGGCGGATTATTTAACGAAGAACCGACGGTTCAAATTCGACGAGTGACATCGACCGAATCAGCTCACA
AGCAGCATCTGTTGCCACCCAAAGCGGATACTTCAGGCACAGAGCGATTGATTGAGGATCTTGCCATTTA
TGGTAGCCCTTTATTGAATGCCGCCACGGAACTGTTGGGTATTTTAGTGACGATTAAGCGTCAAGGCACA
CCGAGAGACATCAACCGTTTTCGTCAAAAACTTTTGTACGCCATTGATGCGTTTCGTTTGCGTGGTTTGC
ACTTGGATTACCACCCAAGCGTGATTGAAAAAAGCTGCTTTGTGTTGTGCGCGGCATTTGATGAAGCTGT
GCTGTACACCGCTTGGGGAGAGCGTGCTCGTTGGGAAAATCATTCGTTGTTGAGCAAGGTGTTTTCACAG
CGCGATGGCGGAGAGGCCTTTTTTGTGTTGCTAGATAAGGCCAGCCAGCAGCCGAATAAACTTGTTGATT
TTATTGAGCTTCAGTACGTGCTTTTGGCTTTGGGTTTCAAAGGGCGCTTTCGCCATGAAGACGAGAGCCA
ATTGCATGATATTACCGCTCGTGCGTACGGTCTCATTCGCCACTATCGCAGTGAAAGTCCTTTTCCGGTA
CCGCAAACACCAACGCTAATCGAAGGTAAACGCCCGTGGCTAATGATCAGTATGGGCAAAACGTTAGGCT
TGGCTTGTTTGGTTCTGGCATCCGGGTATGGTTTTACTGAATATTGGTACAACAGCCGCGTGCAGCCGTT
GTTGGCACAGTTTAGCGCGATCGATATGTCAGACGTCAACCTGAAGAAAAACAGCAGTGACTTAGTGTAC
TTAAGTTCCGATGCGGATTTGGGGCGACAGAGTGAAAGCCTAGAGGAAGAAACTGGAATGAAAGGAAAAG
TGGTCACTCAGCAATGGGAGATCATTCTCGCGGTATTTTCTCGGGCGAGCGACGCACTTCGTTTATCGAC
AGAACTCAAACAGGCAGGCTATGAGTCTTTTACTCGTGAGATGGAACATGGCGTTGAGCTTTATCTTCAC
GCAGGTGACGACTTAAACACCATTCGTAAGTTGAAAAATGAACTCAATGTTCGCTTTGGTTTGAACGCCA
CGATTAAAAGAGCGCTGAAATAA
 Primer design