SecReT6
Protein ID: 336125965
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02833
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]611059..611463 [+]
Producthypothetical protein
NoteTssB
UniProt IDF7YT70
KEGG IDvan:VAA_02833
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.80E-43, Aligned region: 1..123
Protein Sequence: 134 a.a.     [Download]
>gi|336125965|ref|YP_004577921.1| hypothetical protein VAA_02833 [Vibrio anguillarum 775]
MVGDFKGHTEETPLEERQTVSVDKNNFEAVMRESDLKLTTTVRNKLSGDENAELPVELSFKSLADFEPDS
VAAQVPELNKLVELRQALVALKGPLGNIPAFRERLQELLNSEESREKLLSELSLVSGKEEEPQA
 
Nucleotide Sequence: 405 bp     [Download]
>gi|336125405|ref|NC_015637.1|:611059-611463 Vibrio anguillarum 775 chromosome II, complete sequence
GTGGTGGGTGATTTTAAAGGCCATACCGAAGAGACCCCACTTGAAGAGAGACAGACCGTTTCAGTGGACA
AGAACAACTTTGAAGCGGTTATGCGTGAAAGCGATTTGAAACTGACCACTACAGTGCGCAATAAACTGAG
TGGCGATGAAAATGCTGAGCTTCCTGTTGAGCTTAGTTTCAAATCTCTTGCTGACTTCGAACCGGATTCA
GTGGCAGCACAAGTTCCAGAATTAAATAAATTGGTTGAGCTACGCCAAGCTCTTGTGGCCTTAAAAGGTC
CTTTGGGCAATATTCCCGCGTTTAGAGAGCGTCTACAAGAGCTACTAAATTCGGAAGAATCGCGTGAAAA
ACTTCTATCTGAGCTCAGTCTAGTGAGCGGCAAAGAAGAAGAGCCTCAAGCATAA
 Primer design