SecReT6
Protein ID: 336125966
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02834
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]611510..612988 [+]
Producthypothetical protein
NoteTssC
UniProt IDF7YT71
KEGG IDvan:VAA_02834
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-189, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|336125966|ref|YP_004577922.1| hypothetical protein VAA_02834 [Vibrio anguillarum 775]
MMSTTEAVLERQSATQGSLLDEIMAQTRIAPTEEGYDVAKKGVAAFIENLIGSNQTEEPVNKSLVDQMLV
ELDKKISAQMDEILHEERFQQMESSWRGLKLFIDRTDFRENNKVDLLHVTKGELLEDFEFAPETTQSGLY
KHVYSSGYGQFGGEPTGAIIGNFAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIK
DLKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPIKSFNYVESVSASHEHYLWGNTAFA
FATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLVTDRKEFELAEEGFIALTMR
KGSDNAAFFSANSIQKPKIFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLE
RELNGWIKQYVADQENPPADVRSRRPLRAAKIEVMDVEGEPGWYQVSLSVRPHFKYMGANFELSLVGRLD
QA
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|336125405|ref|NC_015637.1|:611510-612988 Vibrio anguillarum 775 chromosome II, complete sequence
TTGATGTCTACTACTGAAGCCGTCTTAGAGAGACAAAGTGCCACCCAAGGCAGTTTACTTGATGAAATCA
TGGCACAAACGCGCATTGCACCGACTGAAGAAGGGTATGATGTTGCGAAGAAAGGGGTTGCTGCGTTTAT
TGAGAATCTCATCGGTTCGAATCAAACGGAAGAGCCAGTTAACAAATCACTCGTTGATCAAATGCTGGTT
GAGCTTGATAAGAAAATCAGTGCTCAAATGGATGAGATTTTGCACGAAGAGCGTTTCCAGCAGATGGAAT
CGTCATGGCGTGGTTTGAAACTGTTTATTGACCGTACCGATTTTCGTGAAAACAACAAGGTTGATTTGTT
GCATGTAACGAAAGGCGAGTTGCTTGAAGACTTTGAATTTGCACCAGAAACGACGCAATCCGGTCTTTAT
AAGCACGTTTATTCTTCTGGTTATGGCCAATTTGGTGGTGAGCCGACTGGCGCTATCATCGGTAACTTTG
CTTTCACGCCATCAACCCCTGACATGAAGCTACTGCAATACATGGGTGCACTTGGTGCGATGGCTCATGC
TCCATTCATTTCTAGTGTCGGCCCTGAGTTTTTTGGTATCGATTCTTTTGAAGAGCTACCAAATATCAAG
GATCTTAAGTCAACATTTGAAAGCCCTAAATACACTAAATGGCGTTCTCTACGTGAATCAGAAGATGCGC
GTTACCTTGGCTTGACTGCGCCTCGTTTCTTATTGCGCGTACCTTATGATCCAACAGAAAACCCAATTAA
ATCATTTAATTATGTGGAAAGTGTCAGCGCTTCACACGAACACTATCTATGGGGTAACACCGCGTTTGCT
TTCGCTACTCGTTTAACCGATAGCTTTGCCAAGTACCGTTGGTGTCCAAACATCATTGGCCCACAAAGTG
GCGGTGCGGTTGAAGATCTGCCAGTACACGTGTTTGAATCGATGGGTGCACTGCAAAGTAAGATCCCAAC
TGAAGTGTTGGTGACTGACCGTAAAGAGTTTGAATTAGCAGAAGAAGGTTTCATTGCTTTAACCATGCGT
AAAGGCAGTGATAACGCCGCATTCTTCTCTGCAAACTCGATCCAAAAGCCAAAAATATTCCCTAATACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACGCAACTGCCATATATGATGATCATCAATCG
CCTTGCACACTACGTCAAAGTGCTACAGCGTGAGCAAATTGGTGCTTGGAAAGAGCGTCAAGATCTTGAA
CGTGAGCTTAATGGCTGGATCAAACAGTACGTGGCTGACCAAGAAAATCCACCAGCAGACGTACGTAGCC
GTCGTCCTCTTCGTGCTGCAAAAATCGAAGTCATGGATGTTGAAGGTGAACCAGGTTGGTATCAGGTCTC
TCTCTCTGTTCGTCCTCACTTTAAGTACATGGGCGCGAACTTTGAATTGTCATTGGTTGGTCGATTAGAT
CAAGCATAA
 Primer design