SecReT6
Protein ID: 336125967
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02835
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]612991..613428 [+]
Producthypothetical protein
NoteTssE
UniProt IDF7YT72
KEGG IDvan:VAA_02835
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-17, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|336125967|ref|YP_004577923.1| hypothetical protein VAA_02835 [Vibrio anguillarum 775]
MTYIAPEESAFGVGFFERLEAGTKPMSLTQGPNAWDVLQSIKRNVSNILNTRMGEAQSAPTLGLVDFNDA
TLETLDLSLRIKLAIQSCLDVYEPRLRNIVIRSESDVFSPLMLRFHIVAEINSDALHEKVQFNLLLDQNR
KYRVY
 
Nucleotide Sequence: 438 bp     [Download]
>gi|336125405|ref|NC_015637.1|:612991-613428 Vibrio anguillarum 775 chromosome II, complete sequence
ATGACTTATATTGCACCTGAAGAGAGTGCATTTGGTGTCGGCTTCTTTGAACGTTTAGAAGCTGGCACCA
AGCCTATGTCTTTGACCCAAGGGCCAAATGCATGGGATGTGCTCCAATCAATCAAACGCAATGTTTCCAA
TATTTTGAATACTCGCATGGGTGAGGCACAAAGTGCTCCAACGTTAGGTTTAGTGGATTTTAACGATGCA
ACGTTAGAAACCTTAGACTTATCGCTGCGGATTAAGCTTGCGATACAAAGCTGCTTAGATGTGTATGAGC
CCCGTTTACGAAATATTGTGATTCGATCCGAGTCGGACGTGTTTAGCCCTTTGATGCTGCGCTTCCATAT
TGTGGCCGAAATAAACAGTGATGCGTTACATGAGAAAGTGCAGTTCAACCTGCTACTGGATCAAAACCGA
AAGTACCGAGTGTATTAG
 Primer design