SecReT6
Protein ID: 336125968
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02837
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]613435..615204 [+]
Producthypothetical protein
NoteTssF
UniProt IDF7YT73
KEGG IDvan:VAA_02837
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-205, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|336125968|ref|YP_004577924.1| hypothetical protein VAA_02837 [Vibrio anguillarum 775]
MAQDKYFREELAFLKEQGKHFTEIHPQLSRFLHGKTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPVPSMSIVSFTPDKSVSDKQQIARGTQLDSKPVFGTKCHFRTCRDVQIYPLKCTDVTAQH
TREATIIEVSLNMLGEISVGDAHLDDLRFYLGGDKYSSQMLYLWLNHYLDKISVEVAGVEFTLPRNSFQT
VGFDSEQSLLPYPSNVYEGYRVLQEYLSFPEAFHFVDITRLASVVPKSVHGAFKLKISFSKTLPADVRVR
QDNFQLYCTPVINLFEHDADPIDLTGKRSEYRIIPSSRYPSHYEVFSVDGVFGWQDKTQASQRIRGEKRV
YSAFESFQHEVERVRNREALYYRTRVRDSIRGDGFDNFISFIRGDETQSMHVDEAISLKLTCTNRLLPLE
LGVGDICEPTDSSPPFATFSNITVPSQSLRPVLDGSLLWVLISNLSLNYLSLLSKDALSSVLRAYDFRAL
VDRQAERVARLRLEGIQKIESQPVDKILRGLPVRGLQSTIHIDQNCFGSEGELYLFGTVLSHFFALYASI
NSFHELIVINASNQEKYTWGTQTGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|336125405|ref|NC_015637.1|:613435-615204 Vibrio anguillarum 775 chromosome II, complete sequence
ATGGCTCAAGATAAGTACTTCAGAGAAGAGCTTGCTTTCCTTAAAGAACAAGGAAAGCATTTCACTGAAA
TTCATCCTCAACTCTCTCGCTTTTTACACGGTAAAACGACGGATCCTGATGTCGAACGTTTATTGGAAGG
CTTCGCCTTTCTCACCGCTCGCTTGCGCGAAAAAGTTGAAGATGAATTTCCTGAGCTAACGCACTCCATC
ATCAACATGCTATGGCCAAACTACTTACGTCCTGTGCCAAGCATGAGTATTGTCTCGTTCACACCGGATA
AAAGTGTCAGTGATAAGCAGCAAATCGCTCGTGGCACTCAGCTCGATAGCAAGCCTGTTTTCGGCACCAA
ATGTCACTTTAGAACCTGTCGTGACGTGCAGATTTACCCACTGAAATGTACTGACGTCACTGCGCAACAT
ACTAGAGAAGCGACCATCATCGAAGTGTCGCTTAATATGTTGGGTGAGATAAGCGTCGGTGATGCGCATC
TTGATGATCTGCGCTTTTACTTAGGTGGTGATAAATACAGCTCACAAATGCTCTATCTATGGCTCAACCA
CTACCTCGATAAGATTTCTGTTGAAGTCGCGGGGGTAGAATTTACGCTGCCGCGCAATAGCTTCCAAACG
GTCGGATTTGATAGCGAGCAGTCGCTTTTGCCCTATCCTTCCAATGTGTACGAAGGTTATCGCGTTTTAC
AGGAATACTTGTCGTTTCCTGAAGCATTTCACTTTGTTGACATTACCCGTCTGGCTAGCGTAGTGCCGAA
ATCAGTGCATGGTGCGTTCAAACTGAAAATCAGTTTTTCGAAAACCCTGCCAGCGGACGTTCGAGTGCGT
CAGGATAATTTCCAGTTGTACTGCACCCCTGTCATTAATTTGTTTGAACATGATGCCGATCCTATCGATT
TAACGGGCAAGCGTTCAGAGTATCGCATTATTCCCTCTAGTCGTTATCCTTCTCACTATGAAGTGTTCAG
CGTTGACGGCGTGTTCGGTTGGCAAGACAAAACTCAAGCCAGCCAACGAATTCGGGGTGAAAAACGTGTC
TATTCAGCATTTGAAAGTTTTCAGCATGAAGTGGAGCGGGTTCGAAATCGTGAAGCGCTCTACTACCGCA
CACGAGTGAGAGACAGTATCCGTGGCGATGGATTTGATAATTTCATCTCTTTCATTCGCGGAGATGAAAC
GCAATCCATGCATGTCGATGAAGCCATCTCGCTCAAACTCACCTGCACCAATCGCTTATTACCGCTCGAA
CTCGGTGTCGGTGACATTTGTGAGCCGACAGACAGCTCGCCCCCCTTTGCCACTTTCAGCAATATTACCG
TGCCTTCACAATCTCTGCGCCCAGTACTGGATGGCAGTCTATTGTGGGTATTGATTTCTAACTTATCGCT
GAATTATTTATCGCTGCTGTCCAAAGATGCCTTAAGCAGTGTGTTGCGAGCTTACGATTTCAGAGCCTTG
GTGGATCGCCAAGCGGAGCGTGTTGCGCGTTTGCGTCTTGAAGGGATCCAAAAAATTGAGTCGCAACCCG
TGGATAAAATATTGCGCGGTTTGCCAGTGCGAGGCCTGCAATCGACGATTCATATTGATCAAAACTGTTT
TGGTTCAGAAGGGGAGCTTTACCTCTTTGGCACAGTGCTTAGCCACTTTTTTGCCCTATATGCCAGCATC
AATTCGTTTCATGAGCTGATCGTTATTAACGCGTCCAATCAAGAGAAGTACACATGGGGAACACAGACAG
GAATGCAGCCATTGATCTAG
 Primer design