SecReT6
Protein ID: 336125969
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02839
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]616195..617667 [+]
Producthypothetical protein
NoteFha
UniProt IDF7YT74
KEGG IDvan:VAA_02839
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.60E-09, Aligned region: 33..100
Protein Sequence: 490 a.a.     [Download]
>gi|336125969|ref|YP_004577925.1| hypothetical protein VAA_02839 [Vibrio anguillarum 775]
MQKKQTLSMVVTNVQLLESGLSAQAMFNVQGGVIGSASDAHWQLRDGKGKIQNHHCAIRVIDGAFCIQDL
VGNTYVNGSHKPLGQGASAKLEHKDEVAIGPYQIRVIFGQVGEDDSLINGSLDQLFAKEGLDLLKDGPLD
DISRDEDEPEPSSMDPIAALDDLLQGIKQEESLLEETEKPLAQAQHSLVPEYDSQQSQLQFTPQADSEYE
MTSSIRLKKILGFGKTSTDLPPIPAVEHHETAQPPTHLNINNSIYNVPEGLAMDDKVLDLLEEEVARSYH
PHSEQHNSSSNNASHLLTGPMLTGLGVDVGNSHDMAKMHMLSEELGQSLQACVQGLLELHQQVSEGRFGM
MNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKNVRDHNEAMQHATSEALNQILNA
FSPQVLLRRFQHYKRNSDAQSNSSDAWAWEMYCHYYQELTSNRQKGFEKLFWEIFEQSYDKKIREKQLEL
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|336125405|ref|NC_015637.1|:616195-617667 Vibrio anguillarum 775 chromosome II, complete sequence
ATGCAGAAGAAGCAAACGCTTTCAATGGTAGTGACGAATGTGCAACTACTGGAATCAGGATTATCCGCAC
AAGCGATGTTTAATGTGCAAGGCGGTGTGATTGGCTCTGCAAGTGATGCGCATTGGCAGCTTCGTGACGG
TAAAGGGAAAATTCAAAATCATCACTGTGCAATCCGTGTGATTGATGGTGCGTTTTGCATTCAAGATCTG
GTTGGTAATACCTATGTTAATGGTTCCCATAAGCCGTTAGGGCAAGGTGCTTCGGCTAAGTTGGAGCATA
AAGATGAAGTGGCCATTGGACCTTACCAAATTCGTGTCATTTTTGGTCAAGTGGGTGAAGATGATTCTCT
GATTAATGGCTCTTTGGATCAGCTGTTTGCTAAAGAGGGGCTCGATCTACTCAAAGATGGTCCATTGGAT
GATATCAGCCGCGACGAGGATGAACCAGAGCCGAGTTCAATGGACCCTATCGCCGCTTTAGATGATTTAT
TGCAAGGCATTAAACAAGAAGAGTCGTTGCTTGAAGAGACGGAAAAACCACTCGCACAAGCACAACATTC
ATTAGTGCCAGAATACGATAGCCAGCAGTCGCAACTGCAGTTTACGCCTCAAGCTGACAGCGAGTATGAG
ATGACGTCATCGATTCGATTAAAGAAAATTCTCGGTTTTGGCAAAACCTCCACCGATTTACCACCTATTC
CGGCTGTTGAGCACCATGAGACTGCGCAACCACCGACTCATTTGAACATTAATAACAGCATTTACAACGT
ACCTGAGGGCTTAGCGATGGACGATAAAGTATTAGATCTACTTGAGGAAGAAGTGGCGAGAAGCTACCAC
CCTCACTCCGAGCAACACAACAGCTCGTCAAACAATGCATCACACTTATTGACCGGCCCCATGCTCACCG
GGCTAGGTGTTGACGTTGGCAATAGCCACGATATGGCGAAAATGCACATGCTTTCAGAAGAGCTTGGGCA
ATCGTTGCAAGCTTGTGTGCAAGGTTTGCTTGAGCTTCACCAGCAAGTGAGTGAAGGGCGTTTTGGTATG
ATGAATCGTAACTTGCAACCGATTGAAGATAACCCACTTCGCTTGGGGCTATCATACGAAGAAACCATTC
GTACTCTGTATGATGCTGATAAAAGTGTGGTGCACTTGTCTGCCCCAGCGGCGATTGCCGAAAGCCTAAA
AAATGTGCGCGATCATAACGAAGCAATGCAGCACGCCACTAGCGAAGCCCTAAATCAGATTCTTAATGCC
TTTTCTCCTCAAGTGCTACTGCGCCGTTTCCAACACTACAAGCGCAATAGTGATGCACAGAGTAACTCTT
CAGATGCTTGGGCGTGGGAGATGTATTGCCACTACTACCAAGAGCTCACTTCTAATCGCCAAAAAGGATT
TGAGAAACTGTTTTGGGAAATTTTCGAGCAGTCTTACGACAAGAAAATTCGTGAAAAACAGCTGGAGCTA
TAA
 Primer design