SecReT6
Protein ID: 336125970
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02840
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]617670..618149 [+]
Producthypothetical protein
NoteTssJ
UniProt IDF7YT75
KEGG IDvan:VAA_02840
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-37, Aligned region: 13..150
Protein Sequence: 159 a.a.     [Download]
>gi|336125970|ref|YP_004577926.1| hypothetical protein VAA_02840 [Vibrio anguillarum 775]
MNKRSFVLLMLLTVLTACSSSEKYEPATQPTKVTFSLVSDEGTNPNIWGEASPIEVQVFELKDDSMFMSA
DYDQVKADYKKALRSNFIANYDYVMTPGQFKFVNAFEIDEGTNYIGVMAHFAEPELSEWKKAVKVLNKGR
EYHLLMYFKDYDVKLERVE
 
Nucleotide Sequence: 480 bp     [Download]
>gi|336125405|ref|NC_015637.1|:617670-618149 Vibrio anguillarum 775 chromosome II, complete sequence
GTGAACAAGCGGTCTTTTGTCCTGCTGATGCTACTGACGGTATTAACCGCCTGTAGCTCATCAGAAAAGT
ATGAGCCAGCCACACAGCCGACCAAGGTAACGTTCAGTCTCGTTAGTGATGAAGGTACTAACCCCAATAT
TTGGGGTGAAGCGTCGCCGATAGAGGTTCAAGTGTTTGAGCTCAAAGATGATTCGATGTTTATGTCTGCC
GATTATGACCAAGTAAAAGCAGACTACAAAAAAGCGTTACGCAGCAATTTTATCGCCAATTACGATTATG
TAATGACACCAGGCCAGTTTAAGTTTGTGAACGCGTTCGAGATTGATGAAGGCACGAACTACATTGGGGT
CATGGCGCATTTTGCTGAACCTGAGCTGAGTGAATGGAAAAAGGCCGTCAAAGTGCTTAACAAAGGTAGG
GAATACCATCTTTTGATGTATTTCAAAGACTACGATGTAAAACTGGAAAGGGTGGAATAA
 Primer design