SecReT6
Protein ID: 336125971
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02841
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]618154..619488 [+]
Producthypothetical protein
NoteTssK
UniProt IDF7YT76
KEGG IDvan:VAA_02841
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-159, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00032, Aligned region: 120..137
GMP_synt_C [PF00958], Evalue: 0.00032, Aligned region: 303..374
Protein Sequence: 444 a.a.     [Download]
>gi|336125971|ref|YP_004577927.1| hypothetical protein VAA_02841 [Vibrio anguillarum 775]
MFARNRVIWNEGLFIKPQHFQQQQRYFEYHIDERISSVSGYLYGVSELSLNPEYLSFGRIAIERAVGIMP
DGTVFRIPQEDVLPDALEIADASLANQLVYLAVPLRSESLMEINWPEERGTGRYLSNRLEVRDVHTVRGD
TTTLDVSPVRVQLMLEKEDRSSYASIAIARILEKRPDGSVVLDPDFIPCHLNVASNAALHRFINEISGLM
RERAKNIAQRISSPSQGGVADVSDFMLLQALNRLQPQMQHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSIPSYNHEMPTHSFGPLIRNLRQSLSIVLEPRAVSIQLDKRKYGLMVAPIHYPQLVESAEFIIAVK
ARMPLDELRRLFTQQTKVSSVEKIRELISLQLPGIPITPLPVAPRQLPYHAGYTYYQLDKTSSAWSMLGR
SSGFAFHVAGAFEDLDLQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|336125405|ref|NC_015637.1|:618154-619488 Vibrio anguillarum 775 chromosome II, complete sequence
ATGTTTGCGCGTAATCGTGTCATTTGGAATGAAGGTCTATTCATTAAACCGCAGCATTTCCAGCAGCAGC
AACGCTATTTTGAATATCATATTGATGAACGCATCTCATCAGTCAGTGGCTATCTTTACGGAGTATCAGA
GTTATCACTTAACCCTGAATATCTCTCTTTTGGTCGTATCGCGATCGAACGTGCGGTCGGCATTATGCCT
GATGGAACCGTTTTCCGTATTCCTCAGGAAGATGTGTTGCCCGATGCGCTTGAGATTGCCGATGCTTCGC
TTGCAAACCAGTTGGTCTATTTAGCGGTGCCACTTCGCAGTGAATCGTTAATGGAGATTAACTGGCCCGA
AGAGCGTGGAACAGGGCGTTACTTAAGCAATCGTTTAGAAGTGCGTGATGTGCATACCGTGCGCGGTGAC
ACCACGACGCTAGATGTCTCACCTGTTCGTGTGCAGTTGATGCTTGAAAAAGAAGACAGAAGCTCTTACG
CCTCAATCGCGATCGCTCGTATTTTAGAAAAACGTCCTGATGGCAGTGTCGTGCTCGATCCGGATTTTAT
TCCGTGCCATCTTAATGTTGCGAGCAATGCGGCTTTGCACCGTTTTATTAACGAAATATCTGGGTTAATG
CGCGAACGTGCCAAAAATATTGCTCAACGTATCAGCTCTCCCTCTCAAGGCGGGGTCGCGGATGTGTCTG
ATTTTATGCTGTTGCAAGCCCTGAATCGCTTACAACCCCAGATGCAACACTTGGCAGAGCTACGCAGTTT
GCACCCGGAACGTTTATTTGAGTGCCTGTCATGCGTATGTGGAGAATTGGCTACATTTACCGATGAAAGT
CGTTTACCACCGAGCATCCCGAGCTACAACCATGAAATGCCGACCCACTCTTTTGGGCCGCTGATCCGCA
ACTTAAGACAGAGCCTAAGTATCGTACTTGAGCCTAGAGCGGTCTCGATTCAGTTGGATAAACGTAAGTA
CGGCCTGATGGTTGCCCCAATCCACTACCCTCAACTAGTTGAAAGCGCAGAATTCATCATCGCGGTGAAA
GCACGCATGCCATTAGATGAACTGCGTCGTCTCTTTACTCAGCAGACCAAAGTATCGTCAGTGGAGAAAA
TCCGCGAGCTCATTTCACTGCAATTACCGGGTATTCCAATTACACCGTTACCAGTTGCACCAAGGCAGTT
GCCTTACCACGCCGGTTATACCTATTACCAATTGGATAAAACCAGCTCAGCATGGTCGATGTTAGGTCGC
TCAAGTGGTTTTGCTTTCCATGTCGCGGGTGCGTTTGAAGATCTTGACCTGCAATTCTGGGCGATTAGGA
GCTGA
 Primer design