SecReT6
Protein ID: 336125972
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02842
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]619488..620264 [+]
ProductDotU
NoteTssL
UniProt IDF7YT77
KEGG IDvan:VAA_02842
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.70E-70, Aligned region: 38..243
HHA [PF05321], Evalue: 0.0024, Aligned region: 16..28
HHA [PF05321], Evalue: 0.0024, Aligned region: 52..88
HHA [PF05321], Evalue: 0.0024, Aligned region: 176..207
Protein Sequence: 258 a.a.     [Download]
>gi|336125972|ref|YP_004577928.1| DotU [Vibrio anguillarum 775]
MMAIDKKNTQYSGLLFDSVEQINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRSLSECENIEQIYKQT
VEEIKAIEIELAEQGFEHAILMAYRYILCAFLDEAVMGTEWGASSVWAEHSMLSRFHSETWGGEKVFTIL
SRLEGEPKRYRALLEFIYQCLVLGFEGKYRVMESGHNEREKVISRLHDTVSSLDENEPKELTSATDHVVK
SKYKLSRQLPVWSVLLGFVIIWVGVFLGYSYLLHSQSADVLNQLNQIL
 
Nucleotide Sequence: 777 bp     [Download]
>gi|336125405|ref|NC_015637.1|:619488-620264 Vibrio anguillarum 775 chromosome II, complete sequence
ATGATGGCCATTGATAAAAAAAACACCCAATACAGCGGTCTGCTTTTTGACAGCGTCGAGCAGATCAACC
ACGACCAAGATTACTGGTTTCAACTGCGTGGTGATAACCCTAATGTTTTGATTGATGCTGCTACCCCTCT
GTTTGGTTTGTCGCTGCGGGTACGCAGCTTGTCAGAGTGCGAAAACATTGAGCAGATCTACAAACAGACG
GTGGAAGAGATTAAAGCGATTGAAATCGAGCTTGCCGAGCAAGGGTTTGAGCATGCGATTTTGATGGCTT
ATCGCTACATTCTGTGCGCGTTTTTGGATGAAGCCGTCATGGGAACCGAGTGGGGTGCATCTAGTGTGTG
GGCTGAACATTCTATGCTGTCTCGTTTCCACAGTGAGACTTGGGGCGGCGAAAAAGTGTTTACCATCTTA
AGTCGCTTGGAAGGTGAACCTAAACGTTATCGCGCGTTGCTAGAGTTTATCTATCAATGCCTAGTGTTAG
GTTTTGAAGGTAAATACCGTGTGATGGAAAGCGGCCACAACGAGCGTGAAAAGGTGATCAGTCGTTTACA
TGACACCGTCAGTTCGTTGGATGAAAACGAGCCGAAAGAACTGACCTCCGCCACCGACCATGTGGTGAAA
TCAAAATATAAGTTAAGCAGGCAGTTACCGGTTTGGTCAGTGCTGCTTGGTTTTGTCATTATTTGGGTCG
GTGTGTTTTTAGGCTATTCCTATTTACTGCACAGCCAATCGGCAGACGTATTAAACCAATTGAACCAAAT
ACTCTAA
 Primer design