SecReT6
Protein ID: 336125976
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02846
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]625137..626534 [+]
Producthypothetical protein
NoteTssA
UniProt IDF7YT81
KEGG IDvan:VAA_02846
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-17, Aligned region: 49..109
FTA4 [PF13093], Evalue: 0.0077, Aligned region: 155..283
Protein Sequence: 465 a.a.     [Download]
>gi|336125976|ref|YP_004577932.1| hypothetical protein VAA_02846 [Vibrio anguillarum 775]
MELTDYRRCITQPIQADNPVGERLIDDPLFDFVEDQMMKVGSLSHASVQWDEVEHSTLKLLSGKSKDLKL
LIYLLQCLHNQVTPLRFTTSLQLLSDFMSLYWEDCFPAPGKRGSLPRRKFFSQIVQRLALVIDKLDFAQF
DGPDRDELNTAIDALQQATTQAGLMSESVESLVAKVQAQLRRATEREQATQHVQETPAVERKTTTQSAIS
VDSSSDKATKQTLLKVAEFLSEQEFGIALAIRVRRFAVWSSITSLPEHDVSGETLLRAMAQERIKEYHDQ
MRSPDLALWRKVEQSLTMAPYWFEGQMMSYQIAQSLGQKAWSEAILSESQQFVARLPALLELKFKGGEPF
VNASVKEWLLSQQQSSAQGQVAGDWQDKRKEAFSLAKEGGIAVALSMLNDGLVSASEPRDKFYWRLLSAD
LLNSNNLDAMAKEQYQTLHAQVSTMSVTDWEPSLVEQLEQYTTSE
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|336125405|ref|NC_015637.1|:625137-626534 Vibrio anguillarum 775 chromosome II, complete sequence
ATGGAGTTAACCGATTATCGCCGCTGTATTACTCAGCCTATTCAAGCCGATAACCCTGTAGGTGAGCGCC
TGATTGATGATCCACTGTTTGATTTTGTTGAAGATCAAATGATGAAAGTGGGGTCACTCTCCCACGCTAG
CGTGCAATGGGATGAAGTCGAACACAGTACGCTCAAACTGCTCAGCGGAAAAAGTAAAGATCTCAAATTA
TTGATCTACTTGTTGCAGTGTTTGCATAACCAAGTCACACCGCTACGTTTCACCACGTCGCTGCAGCTGC
TGAGCGATTTCATGTCCCTTTACTGGGAAGATTGCTTCCCTGCGCCAGGCAAAAGAGGCAGTTTGCCACG
TCGCAAATTCTTCAGCCAGATTGTGCAGCGGTTAGCCTTGGTCATCGACAAGTTAGATTTCGCACAATTT
GATGGACCAGATCGTGATGAGTTAAACACCGCGATCGACGCGCTACAGCAAGCGACTACTCAAGCCGGAC
TGATGTCTGAAAGCGTTGAAAGTCTAGTAGCTAAAGTTCAAGCCCAACTGCGCCGCGCAACAGAACGTGA
GCAAGCGACTCAACATGTGCAAGAGACTCCGGCGGTTGAACGTAAAACCACCACCCAGAGCGCCATCTCA
GTCGACAGTTCAAGTGACAAAGCCACTAAGCAGACCTTACTAAAGGTAGCTGAGTTTTTGTCTGAACAAG
AGTTCGGCATTGCCTTGGCAATACGAGTCAGGCGTTTTGCCGTGTGGTCAAGTATTACCTCATTACCTGA
GCACGACGTCAGCGGTGAAACACTGTTACGGGCGATGGCGCAAGAACGAATCAAAGAGTATCACGACCAA
ATGCGTAGCCCAGATTTAGCCTTATGGCGCAAGGTAGAGCAGAGTTTGACCATGGCACCTTACTGGTTTG
AAGGGCAGATGATGAGCTATCAAATCGCGCAAAGCTTAGGCCAAAAGGCGTGGAGTGAAGCCATTTTGAG
TGAAAGCCAGCAGTTTGTGGCACGTCTACCTGCGCTGCTCGAGTTGAAATTCAAAGGAGGCGAGCCTTTT
GTCAATGCGAGCGTAAAAGAGTGGCTACTCAGCCAGCAGCAAAGTAGTGCCCAAGGCCAAGTAGCAGGTG
ATTGGCAAGACAAACGCAAAGAGGCGTTTAGCTTAGCGAAAGAGGGAGGCATTGCGGTGGCGCTCTCTAT
GCTCAACGATGGTCTGGTCAGCGCCAGTGAGCCAAGGGATAAATTCTATTGGCGGTTATTATCGGCTGAT
TTGTTAAATAGCAATAATTTAGATGCGATGGCGAAAGAACAGTACCAAACGTTACATGCTCAGGTTAGCA
CCATGAGCGTTACCGATTGGGAACCCTCATTAGTTGAGCAATTAGAACAATACACAACGTCAGAGTAA
 Primer design