SecReT6
Protein ID: 336125977
SecReT6 ID446
T6SS typei1
Gene symbol-
Locus tagVAA_02847
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]626552..630097 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDF7YT82
KEGG IDvan:VAA_02847
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.00E-93, Aligned region: 510..824
ImcF-related_N [PF14331], Evalue: 6.10E-81, Aligned region: 89..129
ImcF-related_N [PF14331], Evalue: 6.10E-81, Aligned region: 199..455
DUF1215 [PF06744], Evalue: 1.50E-36, Aligned region: 848..878
DUF1215 [PF06744], Evalue: 1.50E-36, Aligned region: 919..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|336125977|ref|YP_004577933.1| IcmF-like protein [Vibrio anguillarum 775]
MWKFIVGIARKLTPGIAAAMPILLFSTFILLNVAIWWAGPWLEIAGNKPLESITARAVASSLFTLGALAV
WGVWQWRKLQGFKAEQKREDQLRQDPIKAYEERQEVELNQVMVSMKENLNKRNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNHSNDNDGAMERRLWLHF
VNWLERTRSRRPLNGIVLALDVSHLATATATERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGF
EPFFKHYSRSQREDVLGFTFSLDSIDDLDNWLNEFSKDYSQFVERINDVLPHAVSVPMDLEERNAIYSFT
RQISGLKEILLQFFNDALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLDHAINKAQQAKNS
TVYFTQKLFNNIIYPEAGLASDNFRVAKQKRRLIGLSVVAGSIATVLLVGTWHRYYLSNVKHSDAVLAKV
NEYKNEFPSNLYLASQQDVLVPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPMVEATYLNLLENRF
LPLLMADVVVQLNQAKTDEEKLAVLRVYRMMVDKSGRYKDYVLDYFSKYWQQEFAGQRVIQEELLGHLDY
AMLHTDLAGDRARGDRNAESVMKPYDQVVAKVQSDLGSMPNDQRVYRNLKLNAQTVLGPSINLRNLIGPV
FDVVFEERVVNSSSLYIPQMLTKKGFEDYFMPQSESVSELALIDSWVLGQSKSAQFSEADKHDLRNKIRS
LYVADYTNTWRAALNEISVKYFSDINDAVSVLENFTGNIEPMQRLLRTLESNTQMYASVPKDEAAQKELL
KNPKYKVASQIDAPFAELNAMLKPVGDKPAYINEVLVAVEELQNYLKSIQEAPDVGMAALDATKARVKLV
NADPIYTVKRIASGLPKPLDTMVSKLADESWYVVKQEAIKHLEVRWHDDVYKTFEEKLAGRYPFNESSNK
DSSLSDFEAFFAPNGTLDNFYNNQLRMFVEENIAVNDDDNAQSIIRKDVLEQLKQAKKIQQAFFNRKGVL
DVSFSVEPLRLSNNKRRSVLNVDGQYLAYSHGPRDSVELIWPNTLRDSAISKVTLVPTKNNMSPRSINIQ
GPWAFFRLLEQGDVVGASSTSVDFKFAVDGGEMIYRLNSEADINPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|336125405|ref|NC_015637.1|:626552-630097 Vibrio anguillarum 775 chromosome II, complete sequence
ATGTGGAAATTTATTGTTGGGATCGCAAGAAAGTTAACACCGGGCATTGCCGCGGCGATGCCTATTTTGC
TATTTAGCACATTCATTCTATTGAATGTTGCGATTTGGTGGGCAGGCCCTTGGCTAGAGATCGCGGGTAA
TAAGCCACTTGAATCGATAACCGCTCGCGCAGTGGCAAGTAGCTTGTTCACTTTAGGTGCCTTGGCCGTT
TGGGGCGTGTGGCAGTGGCGAAAATTGCAAGGTTTTAAAGCCGAGCAAAAGCGTGAAGATCAGCTTCGCC
AAGATCCAATTAAAGCCTATGAAGAGCGCCAAGAGGTTGAGCTGAACCAAGTGATGGTCAGCATGAAAGA
GAACCTCAATAAACGTAATTATCTCTATGCGTTGCCATGGTATTTAGTGCTCGGTTTGGAAAATGCCGGT
AAAACCAGCCTCATCAACCGCTCTGGGCAAAACTTTGTTTTTTCTTCGGTAATGCGAGCCTCGGGTCAAA
AAAGTGAAAACCCGTATTCGTTTGATTGGTGGATTGGCGATGAATCGGTATTGATCGATCCAGATGGAGA
GCTACTGACACAAGGTAACCACAGCAATGATAACGATGGTGCGATGGAGCGCCGTTTGTGGCTTCATTTT
GTTAATTGGTTGGAGAGAACGCGTAGCCGTCGTCCACTCAACGGTATCGTTTTAGCGTTAGACGTTTCTC
ACTTAGCAACCGCAACTGCAACCGAGCGTAAAGCTTACGCCAATTTATTGCGTGCTCGTTTACGTGAATT
GATGGAGACGTTATCCACGCGTCTACCCGTCTATATTGCATTGACGAAATTGGATTTATTACACGGTTTT
GAACCTTTCTTTAAACATTACTCGCGCAGTCAGCGTGAAGATGTGCTGGGCTTTACCTTTTCGCTCGACT
CTATTGATGACTTGGATAACTGGCTCAACGAGTTTTCAAAAGACTACAGTCAGTTTGTTGAGCGCATTAA
TGATGTACTGCCGCATGCGGTTTCTGTACCTATGGATCTCGAAGAGCGCAATGCTATTTATAGTTTCACG
CGTCAAATTTCTGGTTTAAAAGAGATCTTATTACAATTTTTCAACGATGCATTGGCCAGTGATCAGTTCT
CTACGTCGGCTTTGGTGCGTGGTGCGTATTTCACTTCTGTGTATCAACAGGGCGTACCCACAAACGCATT
TGATGATGCCGCTTCACGTCGTTACGGGCTAGATCATGCGATCAACAAAGCGCAGCAAGCCAAAAACTCA
ACGGTTTATTTCACACAAAAACTGTTTAATAACATCATTTATCCTGAAGCTGGGCTTGCCTCAGATAATT
TTCGTGTTGCGAAGCAAAAACGGCGCTTGATTGGTTTGTCAGTAGTGGCCGGCTCTATTGCAACTGTGTT
ATTAGTTGGCACTTGGCATCGTTATTACCTTAGTAACGTGAAGCACTCTGATGCTGTGTTAGCGAAAGTA
AACGAGTACAAAAACGAGTTCCCCTCTAATCTTTATTTAGCCTCTCAGCAAGATGTTCTCGTGCCGCTCA
ATAAAATTCGAGAGGCGACATTGGAGTTTGGCTTCTTCCGTGATAAACCACAGTACATTTCCGATTTTGG
TTTGTACCAAGGCCACACGATTGGTCCAATGGTTGAAGCGACCTATTTGAATCTATTGGAAAACCGCTTT
TTACCTCTGCTAATGGCTGATGTCGTTGTGCAGCTTAACCAAGCCAAAACAGATGAAGAGAAACTGGCCG
TGCTGCGTGTTTATCGCATGATGGTAGATAAAAGCGGCCGCTATAAGGATTATGTACTCGATTATTTCTC
CAAATACTGGCAGCAAGAGTTCGCTGGGCAACGCGTGATCCAAGAAGAACTACTGGGGCATTTAGACTAC
GCCATGTTACACACGGATTTAGCGGGTGATCGCGCGCGCGGTGATCGCAATGCAGAGTCGGTGATGAAGC
CTTATGATCAGGTGGTGGCGAAAGTGCAGTCTGATCTTGGTTCTATGCCTAACGATCAACGTGTTTACCG
TAATTTGAAGTTGAATGCACAAACGGTTCTTGGCCCCTCGATCAATTTACGCAACTTGATTGGCCCCGTC
TTTGATGTGGTTTTTGAAGAGCGAGTGGTCAACAGCAGCTCGCTGTATATTCCGCAAATGCTTACCAAAA
AAGGGTTTGAAGATTACTTCATGCCGCAATCAGAATCCGTTTCTGAGCTGGCCTTGATCGACAGTTGGGT
ACTAGGGCAATCCAAATCGGCTCAATTTAGCGAAGCGGATAAGCATGACCTTCGTAACAAAATCCGCAGC
TTGTATGTGGCGGACTACACCAATACCTGGCGTGCGGCTCTTAATGAAATCAGCGTTAAGTATTTTAGCG
ACATCAATGACGCGGTGTCAGTATTAGAAAACTTTACTGGCAACATTGAACCGATGCAGCGTTTGCTTCG
CACTTTAGAAAGCAATACTCAAATGTATGCCAGCGTGCCTAAAGATGAAGCCGCGCAAAAAGAGCTGTTA
AAAAATCCAAAATACAAAGTTGCTTCGCAGATTGATGCGCCCTTTGCTGAACTAAACGCTATGCTCAAGC
CAGTCGGTGATAAGCCAGCGTACATCAATGAAGTGTTAGTGGCGGTGGAAGAGTTACAAAATTACCTCAA
ATCTATTCAAGAAGCGCCAGATGTTGGTATGGCTGCGCTTGATGCCACTAAAGCACGCGTAAAATTAGTG
AACGCTGATCCAATTTACACGGTGAAACGTATTGCATCAGGTTTGCCTAAACCGCTCGATACTATGGTGT
CTAAACTGGCGGATGAGAGTTGGTATGTTGTCAAACAAGAAGCGATTAAGCACCTTGAAGTTCGTTGGCA
TGATGATGTTTACAAAACCTTTGAAGAGAAATTAGCTGGGCGCTATCCATTTAATGAGTCATCCAACAAA
GACAGTTCTCTTTCTGACTTTGAAGCGTTTTTTGCGCCCAACGGCACATTAGACAACTTCTACAACAACC
AGCTAAGAATGTTTGTGGAAGAAAATATTGCGGTCAATGATGACGATAACGCGCAGTCGATTATTCGCAA
AGACGTTCTAGAACAGCTCAAGCAGGCGAAGAAAATTCAGCAAGCTTTCTTTAACCGCAAAGGGGTCTTA
GACGTTAGTTTCTCGGTTGAACCACTACGCTTGAGCAACAACAAACGCCGTAGTGTGTTAAATGTTGACG
GTCAATATCTCGCTTATAGTCACGGCCCAAGAGACAGTGTCGAGTTGATTTGGCCAAATACGCTGCGTGA
TTCTGCGATCTCTAAAGTAACGTTAGTGCCGACTAAAAATAATATGTCGCCACGAAGTATTAATATCCAA
GGTCCGTGGGCATTTTTCCGCTTGCTTGAACAAGGTGATGTAGTGGGTGCTAGTTCCACGTCGGTTGACT
TTAAGTTTGCAGTTGACGGTGGTGAGATGATTTATCGACTCAATTCAGAGGCGGATATCAACCCATTCAC
CGAGCGGTTATTTAAGTCATTCAAACTCTCGAAAACCCTTTACTAA
 Primer design