SecReT6
Protein ID: 336250361
SecReT6 ID447
T6SS typei3
Gene symbol-
Locus tagEAE_19425
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4161241..4164852 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDG0E8A8
KEGG IDeae:EAE_19425
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.50E-99, Aligned region: 204..480
IcmF-related [PF06761], Evalue: 6.30E-88, Aligned region: 528..831
DUF1215 [PF06744], Evalue: 6.90E-30, Aligned region: 944..1069
AAA_16 [PF13191], Evalue: 0.004, Aligned region: 139..261
AAA_16 [PF13191], Evalue: 0.004, Aligned region: 806..886
Protein Sequence: 1203 a.a.     [Download]
>gi|336250361|ref|YP_004594071.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MLTLLLSILTNRLLWGFLGATAVAAVIWMIGPLLSIVDTRPLESEQNRVISIALVYLIWAQSHILPRLYN
AWLNRKLMDNLKEDTPKGNDPQQRLNSEDQILADRFDEAAQMLKKAHFSKTGNGQWTQRFSTHYLYQLPW
YVIIGASGSGKTTALANSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQAQDA
SEWLKFMGLLRKYRRRQPINGVIVTVSISDLLTQSTEASRQQAVNLRQRLSELHEQLGIRFPVYVLVTKA
DLLKGFRAWFAGYDKSQRDQIWGFTFPWEQASLADFDLMGRFTQEFALLQQRLEAGLPDTMLQEHDAKTR
AEAWLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGLPFDRVMGELNRALSLPQGNEN
DNWDSVSKEAPIPGAKGQSYFIKNLLQNVIFQEAGIAGQNRWWELRNRAAIWSGYAALAALLIISCVLWL
TSYGKNKAYLQEVSAKVPQIEQQSKALQNPEQRDLFAMLPLLNGLLELPKSADFDVNDPPVSRRMGLYRG
NDVSDASQTLYQKALQQMLLPDVAMRITTWLRNDNGSDAEYSYEALKAYQMLYQPKQYDGKFLLSWVMLN
LQRNLPQNVTQAQLRQLEGHLVQLLEPQIQSSPYAKDDALIARERALINQQPLSSRVYGRLKRLLEHDDN
LKAVSLATLGGPQSELVFSRKSGTPIAEGVPGLYTPDGYWQVFNKQIDNVTSALHEDDIWVLGAASASED
KQQTDNAVRQLYMRDFIANWDRFLADIQLNNSADLSSRINTARLLSASNSPLRRLVISLSQVLNLARAEP
DTVKSESSAEQGNRATRTLEALFRHDEGGATQGAALSQTPEQLVTEHYAPLIELAQPLEKGGKTIVFDDF
LKQIDELYRYLTAVQDAANSGMQPPGGDAISRLQASAGRLPGGLQTMFSKMAVGASSDTQRRDLDNVRKR
INVEVGGFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGMMDTFFRDNLTNKVDTTQSSWRFMPGIDG
KTLPGSEGLLRPFQQAQSIRDAFFANGATTPSFKVTVRTISMDNQILNLTLDVDGQQLRYSHGPQAVQMM
SWPGPGGTNQVRMQLGLADGTTSTLVTSGSWALNRFFDKARTAPGSSSLSRQATFNVDGYQVTLEFAPNS
IRNPFQLPRFSCP
 
Nucleotide Sequence: 3612 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4164852-4161241 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGCTGACACTTCTGCTTTCCATACTGACCAACCGGCTGCTGTGGGGTTTTCTCGGCGCCACGGCGGTGG
CGGCCGTCATCTGGATGATTGGCCCGCTATTGTCGATTGTCGATACCAGGCCGCTGGAATCGGAACAAAA
CCGCGTTATATCTATTGCGCTGGTGTACCTCATCTGGGCGCAAAGCCACATTCTGCCGCGTCTGTACAAC
GCCTGGCTTAACCGCAAGCTGATGGATAACCTGAAGGAAGACACGCCGAAGGGCAACGATCCGCAGCAGC
GCCTCAATAGCGAAGACCAGATCCTCGCCGATCGCTTTGATGAAGCCGCGCAAATGTTGAAAAAAGCGCA
CTTCAGCAAAACCGGTAATGGTCAGTGGACCCAGCGCTTTAGCACCCACTATCTGTATCAGCTGCCGTGG
TATGTGATAATTGGCGCATCCGGCTCCGGTAAAACCACAGCCTTAGCCAACTCCGGGCTGCAGTTTCCGC
TAGCCGACCGCTTCGGTAAAACGGCGTTACGCGGCATCGGCGGCACGCGCAACTGTGACTGGTGGTTTAC
CAACGAAGCCGTGCTGCTGGACACCGCCGGGCGCTATACCACCCAGGAGAGCGAGCAGGCGCAGGACGCC
AGCGAGTGGCTGAAGTTTATGGGGTTATTGCGTAAATACCGCCGCCGCCAGCCGATTAACGGCGTTATCG
TCACGGTAAGTATCTCCGATCTGTTAACGCAATCGACGGAGGCCTCGCGGCAGCAGGCGGTTAATCTGCG
CCAGCGTCTCTCTGAACTACATGAACAATTGGGTATTCGTTTCCCGGTATACGTACTGGTGACGAAGGCC
GATCTGCTTAAAGGCTTCCGCGCCTGGTTTGCCGGTTACGACAAGTCGCAGCGCGATCAAATCTGGGGCT
TCACTTTCCCGTGGGAGCAGGCAAGCCTTGCTGACTTCGATCTGATGGGCCGCTTTACCCAGGAGTTTGC
GTTACTGCAACAACGGCTTGAAGCGGGGCTGCCGGATACGATGCTGCAAGAGCATGATGCCAAAACCCGC
GCCGAAGCCTGGCTGTTCCCGCAAGAGTTTGCGGCGTTGCGACCGCTGTTAGCGGACTATCTTAGTACCG
TTTTTGCCCGCTCTAACTTTGAAACCGAGTTTTCACCGCGCGGCATTTATTTCGCCAGCGGCACCCAGGA
AGGGTTACCGTTCGACCGCGTGATGGGCGAACTCAATCGCGCGCTGTCTTTGCCGCAGGGAAATGAAAAC
GACAACTGGGACTCGGTCAGTAAAGAAGCGCCGATCCCCGGCGCCAAGGGCCAGAGTTATTTCATTAAAA
ACCTGCTGCAAAACGTGATTTTCCAGGAAGCCGGCATCGCGGGGCAGAACCGCTGGTGGGAACTGCGTAA
CCGCGCGGCGATCTGGTCAGGCTATGCGGCGCTCGCGGCGCTGTTAATCATTTCATGCGTACTGTGGTTG
ACCAGCTACGGCAAAAACAAGGCCTACCTGCAAGAAGTCTCGGCGAAGGTGCCGCAGATTGAGCAGCAGA
GCAAAGCGCTGCAAAACCCCGAGCAGCGCGATCTGTTCGCCATGCTGCCGCTACTCAACGGCCTGCTGGA
ATTGCCGAAGAGCGCCGATTTTGACGTCAACGACCCGCCGGTTAGCCGCCGGATGGGGCTCTATCGCGGA
AATGATGTCAGCGACGCCTCGCAGACGCTGTATCAAAAAGCGCTGCAGCAAATGCTGCTACCGGATGTCG
CCATGCGTATCACTACCTGGTTGCGCAACGATAATGGCAGTGACGCCGAATATAGCTACGAGGCGTTGAA
AGCCTATCAAATGCTCTATCAGCCCAAGCAGTATGACGGCAAGTTTTTACTCTCCTGGGTGATGCTTAAC
CTGCAGCGTAACCTGCCGCAAAACGTGACGCAGGCGCAGCTACGACAGCTGGAAGGGCATCTGGTCCAGC
TACTGGAACCGCAAATCCAGTCCTCGCCGTATGCCAAAGACGATGCGCTGATCGCCCGCGAACGGGCGTT
GATTAACCAGCAACCGCTCTCCTCAAGAGTGTATGGTCGGCTGAAACGTCTGCTTGAGCATGACGACAAT
CTGAAAGCGGTCTCGCTGGCGACGCTCGGCGGGCCGCAGAGCGAACTGGTGTTCTCGCGTAAAAGCGGTA
CACCGATCGCAGAAGGCGTGCCAGGGCTGTACACGCCAGATGGCTACTGGCAGGTGTTCAATAAACAGAT
CGATAACGTGACCAGCGCGCTGCATGAAGATGATATCTGGGTGCTGGGCGCCGCCAGCGCGTCGGAAGAT
AAGCAGCAAACCGATAACGCCGTCCGCCAGCTCTATATGCGTGATTTTATCGCCAACTGGGATCGCTTCC
TCGCCGATATTCAGCTCAACAATAGCGCCGATCTGTCATCGCGGATCAACACCGCGCGCCTGCTTTCCGC
CAGTAACTCGCCGCTGCGCCGGCTGGTTATCAGCCTGAGCCAGGTGCTGAACCTGGCGCGCGCCGAGCCG
GATACGGTTAAAAGCGAAAGTTCAGCCGAGCAGGGCAACCGTGCGACCCGAACGCTGGAAGCGCTTTTTC
GCCATGATGAGGGCGGCGCAACCCAGGGCGCGGCGCTTAGCCAGACGCCGGAACAGCTGGTAACCGAACA
CTACGCGCCGCTGATCGAGCTGGCGCAGCCGTTGGAAAAGGGCGGCAAAACGATTGTGTTCGACGATTTC
CTCAAACAGATCGACGAACTTTATCGCTACTTGACCGCGGTACAGGATGCCGCCAACAGCGGTATGCAAC
CGCCGGGCGGCGACGCGATTAGCCGTCTACAGGCCAGCGCCGGGCGCTTACCGGGCGGACTGCAAACCAT
GTTCAGCAAAATGGCGGTCGGCGCCAGCAGTGATACCCAGCGCCGCGATCTTGATAACGTACGTAAACGG
ATTAACGTGGAAGTCGGCGGATTCTGCCGCCAGGCTATCGCCGGGCGCTATCCGCTGGTTCGCAGCGCCA
GTAGTGAAGTCACGCCGGACGATCTGGCGCGTATGTTCGCGCCGGGCACCGGCATGATGGATACCTTCTT
CCGTGACAACCTGACCAATAAAGTCGATACCACGCAGTCCAGCTGGCGTTTTATGCCCGGCATCGATGGC
AAAACGTTGCCGGGTAGTGAAGGGTTATTAAGGCCTTTCCAGCAGGCGCAATCGATCCGCGACGCGTTCT
TTGCCAATGGCGCGACCACGCCGTCATTTAAAGTGACGGTGCGCACCATCAGCATGGACAACCAGATCCT
CAACCTGACGCTGGATGTTGATGGCCAGCAGTTGCGCTACAGCCACGGTCCGCAGGCGGTGCAAATGATG
AGCTGGCCAGGGCCGGGCGGCACCAATCAGGTGCGTATGCAACTCGGTCTGGCCGATGGCACCACCTCGA
CGCTGGTGACCAGCGGCTCATGGGCGCTGAACCGCTTCTTTGATAAAGCGCGCACCGCGCCCGGCAGCAG
CAGTTTGAGCCGTCAGGCAACGTTTAACGTCGATGGTTATCAGGTCACGCTGGAGTTTGCGCCGAACAGT
ATTCGCAATCCGTTCCAGCTTCCCCGTTTCTCATGTCCATAA
 Primer design