SecReT6
Protein ID: 336250848
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21890
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4680737..4682953 [-]
Producthypothetical protein
NoteTssI
UniProt IDG0DZ02
KEGG IDeae:EAE_21890
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-68, Aligned region: 24..328
Phage_GPD [PF05954], Evalue: 1.50E-68, Aligned region: 563..637
Phage_GPD [PF05954], Evalue: 1.50E-68, Aligned region: 663..694
Phage_base_V [PF04717], Evalue: 2.90E-26, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 526..548
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 550..572
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 573..596
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 582..604
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 598..619
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 606..627
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 621..640
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 630..651
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 642..659
Gp5_C [PF06715], Evalue: 2.40E-20, Aligned region: 665..679
Protein Sequence: 738 a.a.     [Download]
>gi|336250848|ref|YP_004594558.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MVNRISILSSVDSSSLLFWKFSGQEKLSEPFHFQVDLLSQDFAIDRQAMLGKNMTVAVPGQWGQVRYLSG
KITAVTVRAEDLGETRYAVYQTTLEPDFWPMMRDRNFRIFQQQRVPDIVAKLFSEHNVKFEDKLTRSYRQ
WDYCVQYAESSFHFISRLLELEGISYLFRHDKDGHTLVLMDDYQQAESFPGYETIPWHAQPGGGAVGEEG
ISQLMASHVVTPGLYSTDDYDFRKPHAWMLQTLQNPVSPTPGKIDVYDWPGRFMEHGDGEAYARIRQQSW
QAEQQQTQGIATATGIVPGHTFTLTHAPNMADNAKWLVVGARYDFEENQYASGGGNTAQHRIAFTVIPAA
TPFVPASRTDWPRTYGPQTARVVGPKGESIWTDKYGRIKVKFHWDRESQGDENSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGEPDRPIVIGRVYNEASMPPWALPAAATQMGFMSRSKDGSPDNANALRFEDKP
GEEQLWLHAERNMDTEVENDETHDVGNNRTKTVGKDETSHIKQNRTRTVDGNESVTVGKDRSKTINGNET
TTVEQNRTESVKGNETLSVEQNRDETISGNHTTTVKSDHTATVEGKQSLTVVQDRTRQVQGNESVSVQQN
RNVQVTGNQTLGVTGNHDISVTGKQTQTITSKQEVTIGAGRTLSITGGDTRFTQGSVTDSATDTVHINVG
ESGILISNGSVEITAGGSTITINAAGVMVNGKKIELNA
 
Nucleotide Sequence: 2217 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4682953-4680737 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGTTAATCGGATATCGATCCTGTCATCTGTCGACAGCTCCTCGTTATTATTCTGGAAATTCAGCGGGC
AGGAGAAACTGTCCGAACCTTTCCACTTTCAGGTCGATTTACTCAGCCAGGATTTTGCTATCGACCGTCA
GGCCATGCTCGGCAAAAACATGACGGTGGCGGTTCCCGGCCAATGGGGACAGGTGCGTTATCTTTCCGGC
AAAATCACCGCCGTTACCGTACGCGCCGAAGATCTTGGCGAGACGCGCTACGCCGTCTATCAGACCACGC
TGGAACCCGATTTCTGGCCGATGATGCGCGACCGCAACTTCCGTATTTTCCAGCAGCAGCGGGTGCCGGA
TATCGTGGCCAAACTGTTTAGCGAGCATAACGTTAAGTTTGAGGACAAACTTACGCGTAGCTACCGGCAG
TGGGATTATTGTGTGCAGTATGCGGAAAGCAGCTTCCATTTCATCAGCCGTTTGCTGGAGCTGGAAGGTA
TTAGCTATCTGTTCCGCCACGATAAAGACGGCCATACCCTGGTGCTGATGGATGACTATCAGCAGGCTGA
ATCCTTCCCCGGTTATGAAACTATTCCCTGGCATGCGCAACCGGGCGGCGGCGCGGTCGGCGAAGAGGGC
ATTAGCCAGCTGATGGCGAGCCACGTCGTCACGCCGGGGCTTTACAGCACCGATGACTATGATTTTCGCA
AGCCCCACGCCTGGATGCTGCAAACGCTGCAGAATCCGGTCTCGCCGACGCCGGGCAAAATCGACGTTTA
CGACTGGCCGGGGCGCTTTATGGAGCACGGCGACGGCGAAGCCTACGCCCGTATTCGTCAGCAGTCCTGG
CAGGCCGAACAGCAGCAAACGCAGGGTATCGCCACCGCGACCGGTATCGTCCCGGGACACACGTTTACCC
TGACGCATGCGCCTAACATGGCTGATAACGCTAAATGGCTGGTGGTGGGCGCCCGCTATGATTTTGAAGA
GAATCAGTATGCCTCCGGCGGCGGAAATACCGCGCAGCACCGCATCGCATTCACTGTTATTCCCGCCGCG
ACGCCATTTGTCCCCGCGTCAAGGACCGACTGGCCGCGCACCTACGGGCCGCAAACCGCCCGCGTGGTAG
GGCCGAAAGGAGAATCGATCTGGACCGATAAATATGGCCGGATTAAGGTGAAATTCCACTGGGACCGCGA
AAGCCAGGGCGATGAAAATAGCTCCTGTTGGGTGCGCGTTTCCAGCGCCTGGGCCGGCCAGGGTTACGGC
GGGGTGCAGATCCCACGCGTCGGTGATGAAGTGGTGGTGGACTTTATCAACGGCGAGCCGGACCGGCCGA
TTGTCATTGGCCGCGTCTATAACGAAGCCAGTATGCCGCCGTGGGCGCTACCGGCTGCAGCCACGCAAAT
GGGCTTTATGAGCCGCTCAAAGGATGGTTCGCCGGACAACGCCAACGCCCTGCGTTTTGAAGATAAACCC
GGCGAAGAGCAGCTCTGGCTGCACGCCGAGCGCAACATGGATACTGAAGTCGAAAACGACGAGACCCATG
ATGTCGGCAATAACCGCACCAAAACCGTCGGCAAAGACGAAACCAGCCATATCAAACAGAACCGCACCCG
CACGGTGGATGGCAACGAAAGCGTTACCGTCGGCAAAGATCGCAGCAAAACCATCAATGGTAATGAAACC
ACCACCGTTGAGCAGAACCGTACCGAAAGCGTGAAGGGGAATGAGACCCTAAGCGTTGAGCAGAACCGCG
ATGAAACCATCAGCGGCAACCATACCACCACGGTGAAAAGCGACCATACCGCGACCGTCGAAGGCAAGCA
GTCACTGACGGTCGTACAGGATCGCACCCGCCAGGTGCAGGGTAACGAAAGCGTCAGCGTCCAGCAGAAC
CGTAACGTGCAGGTCACCGGCAACCAGACGCTGGGAGTGACCGGCAATCACGATATTTCCGTGACCGGTA
AGCAAACGCAGACCATCACCAGTAAGCAAGAGGTGACGATCGGCGCCGGGCGTACCCTGAGCATCACCGG
CGGTGATACCCGCTTTACGCAAGGGAGCGTAACCGACAGCGCTACCGATACCGTACATATCAACGTGGGC
GAAAGCGGCATTCTGATAAGCAACGGCAGCGTGGAGATTACCGCTGGCGGGTCGACGATCACCATTAACG
CCGCCGGCGTGATGGTGAATGGTAAGAAGATTGAGCTCAATGCCTGA
 Primer design