SecReT6
Protein ID: 336250851
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21905
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4685390..4685929 [-]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDG0DZ05
KEGG IDeae:EAE_21905
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.30E-35, Aligned region: 17..169
Protein Sequence: 179 a.a.     [Download]
>gi|336250851|ref|YP_004594561.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MLHITSLKLSALILLPFMLAGCGLTQKISDGASSAVKSVFYRQVKTLRLDFSARNALNTDNREDNSASQP
VMVRVYVLKDRKTFEKTVYQQLAAEGEDILKDDQLASRSLVLKPGTAMSLTMPLDEQAQYVAVVALFRAP
DLTKNDWKLVLAREDLDPDRARVIEASHHQLVLQPRKEK
 
Nucleotide Sequence: 540 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4685929-4685390 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
GTGTTGCATATCACTTCGCTTAAACTATCCGCACTGATTCTTCTGCCGTTCATGCTGGCGGGTTGCGGGC
TAACACAGAAAATCAGCGACGGCGCTTCGTCCGCCGTAAAGTCAGTATTTTATCGCCAGGTGAAAACGCT
GCGTCTGGATTTTAGCGCGCGCAATGCGTTAAACACCGATAACCGTGAGGATAACAGCGCCTCCCAGCCG
GTGATGGTACGGGTCTATGTGCTGAAAGATCGCAAGACTTTCGAGAAGACGGTTTACCAGCAGCTGGCGG
CGGAAGGAGAGGACATATTAAAAGACGATCAACTGGCCAGCCGCAGTCTGGTGCTCAAACCGGGAACGGC
GATGAGTCTCACCATGCCGCTGGATGAACAGGCGCAGTATGTCGCCGTGGTGGCGCTGTTTCGGGCGCCG
GATCTGACGAAAAACGACTGGAAGCTGGTGCTTGCCCGCGAGGATCTTGACCCGGACCGCGCGCGCGTCA
TTGAGGCCAGCCATCATCAACTTGTTCTGCAACCGCGGAAGGAGAAGTGA
 Primer design