SecReT6
Protein ID: 336250852
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21910
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4685907..4686992 [-]
Producthypothetical protein
NoteTssG
UniProt IDG0DZ06
KEGG IDeae:EAE_21910
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-75, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|336250852|ref|YP_004594562.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MAGEPQTPHSRLSPRLERDIQRINFYRFCQLLEKSRPGAPALGSTLNPADDPVRFRPHPGMGFPVSELKA
VEYDEAHPDAPPTLRTTFMGLYGVDSPLPTAWLDDIAQQREGHEAQEAFLDIFNHRILSQFYRIWRKYLY
PATFEDGGRDRTSQSLLGLIGLGIPGTAQHIAAPVSRFLALLSVMRLPARTEEGIQALVRLLAPHTRAEA
SPHCPRTVYPAQPLGFYGDNDFLLDGYTVLGDETTEIASQLLIALYTDDIAEAAGWMPEGQIYADFLVLL
RVYLGWRYKAKITLTLPTPLLPAPVLGESPFMLGISGVLGMEGDAVPPDLPATFTTELGGYRGMPLASLS
QGNQRVAYHFA
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4686992-4685907 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCAGGAGAACCACAAACGCCGCATTCCCGGCTGAGCCCGCGGCTGGAGCGGGATATTCAGCGCATCA
ACTTTTACCGCTTCTGCCAGCTACTGGAAAAATCGCGACCCGGCGCGCCGGCATTAGGCAGCACGCTAAA
CCCGGCGGATGATCCGGTACGCTTTCGCCCGCATCCGGGGATGGGTTTTCCGGTCAGCGAACTCAAAGCG
GTGGAGTATGATGAGGCGCATCCCGACGCGCCGCCGACGCTGCGCACCACCTTTATGGGGCTATACGGTG
TCGATTCGCCGTTGCCCACCGCCTGGCTGGATGATATTGCGCAGCAAAGAGAAGGGCATGAGGCGCAGGA
AGCATTTCTCGATATTTTTAACCACCGCATTCTGAGCCAGTTTTATCGCATCTGGCGCAAATACTTGTAT
CCGGCAACCTTTGAAGACGGCGGTCGCGACCGTACTTCACAGAGCCTGCTGGGGCTGATCGGGCTGGGCA
TTCCCGGCACCGCTCAGCATATTGCCGCGCCGGTATCTCGCTTTCTGGCATTACTCAGCGTGATGCGCCT
GCCCGCGCGTACCGAAGAGGGGATTCAGGCGCTGGTACGATTGTTGGCACCCCATACGCGGGCGGAAGCG
TCGCCGCACTGCCCACGGACGGTGTACCCGGCGCAGCCGCTGGGTTTTTACGGCGATAACGATTTCCTGC
TTGATGGCTACACGGTGCTGGGCGATGAAACGACCGAGATTGCCAGCCAGTTGCTGATCGCGCTGTACAC
CGATGATATCGCCGAGGCCGCAGGCTGGATGCCGGAAGGGCAAATCTATGCGGACTTTCTGGTTCTGCTG
CGGGTTTATCTCGGCTGGCGCTATAAGGCCAAAATCACCTTAACGCTTCCCACGCCGCTGTTACCCGCGC
CGGTACTCGGTGAATCGCCGTTTATGCTCGGCATCAGCGGCGTTCTGGGCATGGAAGGGGACGCGGTTCC
GCCGGATTTACCGGCCACGTTTACCACGGAACTGGGCGGCTACCGCGGCATGCCGCTTGCATCATTATCA
CAAGGAAACCAACGTGTTGCATATCACTTCGCTTAA
 Primer design