SecReT6
Protein ID: 336250853
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21915
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4686956..4688716 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDG0DZ07
KEGG IDeae:EAE_21915
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-179, Aligned region: 6..581
Protein Sequence: 586 a.a.     [Download]
>gi|336250853|ref|YP_004594563.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAALNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTGGLVSMIWPHYLRTIPSLAMVEFSVDWREMKEPQRLKKGTEVISRPIGETGTRCRYTTTQPLTLQPLA
LSRASVRAQADGRQAICLRFDCSALVDWRALDLSRIPLYLNADAPLACALHEALTLNVARIGIRLAGEAD
SRPLAAHFAVCGFGHDDALLPQSGGFSGYQLLLEYFSFREKFMSVALCGLENMTFPDAPGWFEIEVVLDK
PWPQEYALSEKHLRLHCSPVINLFPLESDPLHLDSLQSEYLLRPMRVQDGHTEIYSVESVTSSRLSGTQA
YVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLTLGGEAFDQHRVPQNETLSLSLIGTNGQLPR
RALQSTLLDTVVKSTTSRLQVRNLSAPTLPCYPPDRDRFHWRVLSHLGSSFLWMMDNAEVLRGALALYDW
TDNEMNRRRLLAIVDVSHCEVERFAEGHFLRGVQIEVTLDGNGFAGHGDICLFGEMLNRFFALYTDIHLF
NRLILILQPTGERLEWQENHKRRIPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4688716-4686956 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGACGATTTAACTCTGCGTTATTTTGACGCTGAAATGCGCTATCTGCGTGAGGCTGGCGAGGAGTTTG
CCCGCGCCCATCCCGATCGCGCCGCGGCGTTAAACCTCGATAAAGCCGGCGCCCGCGATCCCTATGTTGA
GCGCCTGTTCGAAGGTTTTGCTTTCCTGATGGGGCGGCTGCGCGAAAAGCTCGACGACGACCTGCCGGAG
CTGACCGGCGGGCTGGTGAGTATGATCTGGCCGCATTATCTCCGTACCATTCCGTCGCTGGCGATGGTGG
AGTTCAGCGTCGACTGGCGGGAGATGAAAGAGCCGCAGCGGCTGAAGAAGGGAACGGAAGTGATCTCCCG
GCCCATCGGCGAGACGGGCACCCGCTGCCGTTACACCACGACCCAGCCGCTAACCTTACAGCCGCTCGCG
CTCTCCCGCGCCAGCGTCAGGGCGCAGGCCGACGGCCGCCAGGCGATTTGTCTGCGTTTTGACTGTAGCG
CGTTGGTGGACTGGCGGGCGCTCGACCTGAGCCGTATTCCGTTGTATCTGAATGCCGACGCGCCATTGGC
CTGCGCGCTGCATGAAGCGCTGACCCTGAATGTGGCACGCATCGGCATACGCCTGGCGGGGGAGGCCGAT
AGCAGGCCGCTGGCGGCCCATTTTGCCGTTTGCGGTTTTGGCCATGATGATGCGCTGCTGCCCCAAAGCG
GCGGGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCAGCTTTCGTGAAAAGTTTATGTCGGTCGCGCT
GTGCGGGCTGGAGAATATGACGTTTCCTGATGCGCCGGGATGGTTTGAGATCGAGGTCGTGCTGGATAAA
CCGTGGCCGCAGGAGTATGCGTTGTCAGAGAAACATCTGCGTTTACACTGCAGCCCGGTTATTAACCTGT
TCCCGCTGGAGTCGGATCCGCTGCATCTGGATTCACTACAAAGTGAGTATCTGCTGCGCCCCATGCGCGT
CCAGGATGGACACACCGAAATCTATTCGGTGGAGTCCGTCACTTCCTCCCGCCTTTCCGGCACCCAGGCG
TATGTGCCGTTTACCAGTTTTCGCCACAAAGGCGGCATGTTGCGCCATGATGCGCCGGAATATTATTACC
ACACGCGCGTTAAACGTGGCCCGTCCGGGCTGCATGATACCTGGCTGACGCTGGGCGGCGAGGCGTTTGA
CCAGCATCGCGTGCCGCAGAATGAAACTCTGTCATTGAGCCTGATCGGCACCAACGGCCAGCTGCCGCGG
CGGGCGCTGCAAAGCACGCTGCTGGACACGGTGGTCAAATCCACGACGTCGCGGCTCCAGGTGCGCAATC
TCAGCGCGCCGACGTTGCCGTGTTATCCACCGGATCGCGACCGTTTTCACTGGCGGGTGCTGAGCCATCT
CGGCAGCAGCTTCCTGTGGATGATGGATAACGCCGAGGTGTTGCGCGGCGCGCTGGCGTTGTACGACTGG
ACGGACAACGAAATGAACCGCCGTCGCCTGCTGGCGATCGTCGACGTGAGCCACTGTGAGGTGGAACGTT
TTGCCGAGGGGCACTTTCTACGCGGCGTGCAGATAGAGGTGACGCTCGACGGTAACGGCTTCGCCGGGCA
CGGCGACATCTGCCTGTTTGGCGAGATGCTCAACCGCTTCTTTGCCCTGTATACCGACATCCATCTGTTT
AATCGTCTGATTCTGATACTGCAACCTACCGGAGAGCGTCTCGAATGGCAGGAGAACCACAAACGCCGCA
TTCCCGGCTGA
 Primer design