SecReT6
Protein ID: 336250854
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21920
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4688789..4692172 [-]
Producthypothetical protein
NoteTssM
UniProt IDG0DZ08
KEGG IDeae:EAE_21920
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.80E-71, Aligned region: 412..727
DUF1215 [PF06744], Evalue: 2.30E-36, Aligned region: 850..970
Protein Sequence: 1127 a.a.     [Download]
>gi|336250854|ref|YP_004594564.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MFKEKNAAVMTVAATATLCLAVWTTVVLLSGLGWWNWHANRTLQWTAIREIVTVCGLIWAYGLCLWILGF
IAFHLFIRQKADGQQRQTQTFISQQTKPAQPFASLKHFLRRRYGRLWRNKVRLLWVAGEAAQIAAIAPGL
AQQQWLEGRGTVLIHGGSLSATVDIERLSALRRLRGRRPLDGIVLALDNAQATAATLDGYLRTLEQVAQV
LRYQPPVYLWQLHDSDWPQDTRITQTLGALFPPRAVPQDVERQLRAILPAMLAQGTQQLCADSSHDYLLR
VAKWLKEGGISGWKTLLTPWLTGHLQQIPLRGLLFSPSLKAEEAVDNGLYPHRWPAPAVWQGIIADCGRA
RGVPVGVAWRPSLGVGLLALIALWAAGSLLSFIVNRQQIVSATQRVQLLRQPVVNDQQLIDLQVLRNDIG
RLQNQLANGTPWYQRFGLNHNAPLSAALLPWYGRANQRLIRDAAAQALTRQLTVLVNLPPRSPQRAQLAK
AGYDQLKAYLMMARPDKADAAFYRQAMTAAQQTCQGVAPALWQSIAPDLWGFYMDNLPSQPTWRITPDAV
LVTQARQVLLAQIGRRNAESTLYENMLLQVRRNYADMTLEDMTPQTNASRLFTTEEVVPGMFTRQAWEGG
VREAIDKAVATRRDEIDWVLSDSRQTVSGDVSPEALKQRLTDRYFTDFAGAWLGFLNSIRLNPARNIADV
TDQLTLAGDVRQSPLIALMNTLAWQGQTGQQREGVADSLVKSAKNLLDKDKQPFIDQQAGGARGPLESTF
GPLLALMGKNPSQSVVAADSTLSLQTWLTRLTRVRLRLQQVANAPDPQAMMQQLAQTVFQGKSVDLTDTQ
EYGSLVAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNEAWQRSVVANWHSAFDGRYPFAAGKNDV
SLPMLAAFIRRDSGRIDQFLARQLGGVLNREGSRWVADSAHSQGLTFNPAFLKAINQLSSLSDILFTDGS
QGMGFELQGVATPGIVETQLTLDGQNLHYFNQLAEWKSFRWPGTINKPGAMLSWSSVAAGARLLANDSGP
WGTLRMLERMKRQQIGDGLFRLTVNTPDNRQLQWLLRTELGDGPLALLKLRNFTLPTQIFIVEASQAEPF
ADGDVEE
 
Nucleotide Sequence: 3384 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4692172-4688789 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGTTCAAGGAAAAAAATGCCGCGGTAATGACCGTAGCGGCTACCGCGACCCTGTGTCTTGCCGTCTGGA
CAACTGTGGTCCTGCTGAGCGGTCTGGGATGGTGGAACTGGCACGCCAACCGCACGCTGCAGTGGACGGC
GATCCGCGAGATAGTGACCGTCTGTGGCCTGATTTGGGCGTATGGTCTCTGTCTCTGGATACTGGGCTTT
ATTGCTTTCCACCTGTTTATCAGGCAAAAAGCCGATGGGCAACAGCGTCAGACGCAGACTTTTATTAGCC
AGCAGACAAAACCGGCGCAGCCGTTTGCGTCCTTAAAGCACTTTCTCCGTCGCCGCTACGGCCGATTGTG
GCGCAATAAGGTCCGCCTGCTGTGGGTCGCTGGCGAGGCGGCGCAGATTGCCGCCATCGCTCCAGGCCTT
GCGCAACAGCAATGGCTGGAGGGCCGCGGTACGGTGCTAATTCACGGCGGTAGCCTGTCGGCGACGGTGG
ATATCGAGCGGCTCAGCGCCCTGCGTCGGCTGCGCGGCCGCCGGCCGCTGGATGGTATCGTGCTGGCGCT
GGACAATGCTCAGGCCACCGCCGCGACCCTGGACGGGTATTTGCGAACGCTGGAGCAGGTTGCGCAGGTT
CTGCGCTACCAGCCGCCGGTCTATCTGTGGCAACTCCACGACAGCGACTGGCCGCAGGATACGCGCATTA
CCCAGACGCTGGGGGCGTTGTTCCCGCCGCGGGCCGTCCCGCAGGATGTTGAACGGCAGCTTCGCGCCAT
TCTGCCCGCCATGCTGGCGCAGGGGACCCAGCAGTTGTGCGCTGATTCGTCCCACGATTACCTGCTGCGT
GTCGCTAAATGGCTGAAGGAGGGTGGTATCAGCGGCTGGAAGACGCTACTGACGCCGTGGCTTACCGGGC
ATCTGCAACAGATCCCGCTCCGTGGTCTGCTGTTCAGCCCCTCGTTAAAGGCGGAAGAAGCGGTGGACAA
TGGGCTCTATCCCCACCGTTGGCCGGCCCCGGCCGTCTGGCAGGGGATCATCGCAGACTGCGGCCGCGCG
CGCGGCGTGCCGGTGGGGGTGGCGTGGCGCCCCTCCCTCGGCGTCGGCCTGCTGGCGCTGATTGCTCTGT
GGGCGGCGGGAAGCCTGCTCTCTTTTATCGTCAACCGCCAGCAAATTGTCAGCGCCACCCAGCGGGTACA
GCTGCTGCGGCAGCCCGTCGTTAACGACCAGCAGCTGATCGATTTGCAGGTGCTGCGCAACGATATCGGC
CGTCTACAGAATCAGCTCGCCAACGGCACGCCCTGGTATCAGCGCTTTGGTCTTAATCATAATGCGCCGC
TTTCTGCCGCGCTGCTGCCGTGGTATGGGCGGGCTAACCAGCGCCTGATCCGCGACGCCGCGGCGCAGGC
GCTGACCCGGCAACTGACGGTGTTGGTCAACCTGCCGCCGCGCAGCCCGCAGCGGGCGCAGCTGGCGAAA
GCGGGTTATGACCAGTTAAAGGCCTATCTGATGATGGCGCGTCCGGACAAAGCCGATGCGGCGTTTTACC
GCCAGGCAATGACCGCGGCGCAGCAGACGTGTCAGGGAGTCGCCCCGGCGCTATGGCAGAGCATCGCCCC
CGATTTATGGGGCTTCTATATGGACAACTTGCCGTCGCAGCCGACGTGGAGAATCACCCCGGACGCCGTG
CTGGTGACGCAAGCGCGTCAGGTGCTGCTGGCGCAAATCGGGCGGCGCAACGCCGAAAGCACACTTTACG
AGAACATGCTGCTGCAGGTGCGCCGTAACTATGCCGACATGACGCTGGAAGACATGACGCCGCAGACCAA
TGCCAGCCGGTTGTTTACCACGGAAGAGGTGGTGCCGGGGATGTTTACCCGTCAGGCGTGGGAGGGCGGC
GTGCGCGAGGCGATCGATAAGGCGGTGGCGACCAGGCGCGATGAGATCGACTGGGTGCTGAGCGATAGCC
GCCAGACCGTCAGCGGCGACGTCTCCCCGGAGGCGTTGAAACAGCGGCTGACCGATCGTTATTTCACCGA
TTTCGCCGGGGCGTGGTTGGGTTTTCTCAATAGCATCCGCTTGAATCCGGCGCGCAATATTGCCGATGTG
ACCGATCAGTTGACGTTGGCGGGCGACGTTCGTCAGTCGCCGCTGATTGCGTTGATGAATACCCTTGCCT
GGCAGGGGCAGACCGGGCAGCAGCGTGAGGGCGTGGCGGATTCGCTGGTGAAATCGGCAAAAAATCTACT
CGATAAGGATAAGCAGCCGTTTATCGACCAGCAGGCCGGCGGCGCGCGCGGCCCGCTGGAGAGTACCTTT
GGGCCGCTGCTGGCGCTGATGGGCAAAAATCCCTCTCAAAGCGTGGTCGCCGCAGACAGCACCCTCAGTT
TACAGACCTGGCTGACGCGCCTGACCCGCGTACGCCTGCGGCTCCAGCAGGTGGCAAACGCCCCCGACCC
GCAGGCGATGATGCAGCAGCTGGCGCAGACCGTGTTCCAGGGTAAAAGCGTCGACCTGACCGACACCCAG
GAGTACGGCAGCCTGGTGGCGGCCAGCCTCGGCGAAGAGTGGAGCGGTTTCGGCCAGACCATGTTCGTCC
AGCCGCTGACGCAGGCCTGGGAAACGGTGCTGCAGCCATCGGCTGCCAGCCTGAACGAGGCGTGGCAGCG
TTCTGTGGTCGCTAACTGGCATTCGGCTTTCGACGGCCGCTATCCGTTTGCCGCGGGCAAAAACGATGTC
TCGCTACCGATGCTGGCGGCATTCATCCGTCGCGATAGCGGGCGAATCGACCAGTTTCTTGCCCGACAGT
TGGGCGGCGTGCTCAACCGGGAGGGTAGCCGCTGGGTGGCCGATAGCGCGCACAGTCAGGGGCTGACTTT
CAATCCGGCCTTCCTGAAGGCGATTAATCAACTGAGTTCCTTGTCCGACATCCTGTTTACCGACGGCAGT
CAGGGAATGGGGTTTGAACTACAGGGGGTGGCGACGCCGGGCATTGTTGAAACGCAACTCACCCTCGACG
GCCAGAATCTGCACTACTTTAACCAGCTTGCCGAATGGAAAAGTTTCCGCTGGCCGGGGACTATCAACAA
ACCCGGCGCGATGCTGAGCTGGAGCTCAGTGGCGGCGGGCGCTCGGCTATTGGCGAACGACAGCGGCCCG
TGGGGCACGCTGCGTATGCTGGAGAGAATGAAGCGCCAGCAGATCGGCGATGGGCTGTTTCGTCTGACGG
TCAATACGCCGGATAACCGGCAACTGCAGTGGCTGCTGCGTACCGAACTCGGCGATGGCCCGCTGGCGTT
GCTGAAACTGCGAAACTTCACGTTGCCGACACAGATTTTCATCGTGGAGGCCTCCCAAGCAGAACCGTTT
GCCGACGGTGACGTAGAGGAATAA
 Primer design