SecReT6
Protein ID: 336250864
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21980
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4703434..4703691 [-]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDG0DZR7
KEGG IDeae:EAE_21980
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-18, Aligned region: 6..77
Protein Sequence: 85 a.a.     [Download]
>gi|336250864|ref|YP_004594574.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MKPIIRQGDTLREHGGTVIGGHYLCFGKGIACKGDQVSCNEHGLTVIAEGSSLYEVDGSPVALDGHHCAC
GCTLVSSRPDCEVAL
 
Nucleotide Sequence: 258 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4703691-4703434 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
TTGAAACCCATTATTCGGCAGGGTGATACCTTGCGTGAGCATGGCGGTACGGTGATCGGCGGCCATTATC
TCTGTTTTGGTAAAGGCATCGCCTGCAAAGGCGACCAGGTGAGCTGCAATGAACATGGCCTGACGGTCAT
AGCCGAAGGAAGCTCGCTGTATGAAGTGGATGGTTCTCCGGTGGCTCTTGACGGGCATCATTGCGCCTGC
GGCTGTACGCTGGTGAGTTCACGCCCTGATTGCGAAGTCGCGCTATGA
 Primer design