SecReT6
Protein ID: 336250865
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21985
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4703731..4706109 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG0DZR8
KEGG IDeae:EAE_21985
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-60, Aligned region: 33..350
DUF2345 [PF10106], Evalue: 9.60E-38, Aligned region: 613..759
T6SS_Vgr [PF13296], Evalue: 6.90E-32, Aligned region: 489..594
T6SS_Vgr [PF13296], Evalue: 6.90E-32, Aligned region: 629..662
Phage_base_V [PF04717], Evalue: 4.30E-17, Aligned region: 388..482
Sarcoglycan_1 [PF04790], Evalue: 0.0084, Aligned region: 624..658
Sarcoglycan_1 [PF04790], Evalue: 0.0084, Aligned region: 681..724
Protein Sequence: 792 a.a.     [Download]
>gi|336250865|ref|YP_004594575.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSDIKPLLFNHSHHLLQVHGCNSLLDVLCFEGEENLSEPFRYTIEFTSSDKAITPQQMLLQNASLTLQAP
VDQGFGIKIQQPVRVLQGVITSFERLSIAKEETRYALTLQPRLALLSKSHQNRIYQDMSAPQIVEHILRT
RHQMRGEDFVFQLAHEYPQREQVMQYGEDDLTFISRLLGEVGIWFRFTADTRLNIDVAEFYDDQQHYETG
LLLPSVAPSGQHDGGNESVWDLQSRHHVVERSVFTRDYNYRNAPEDMNLNVNVSRGDSTTYGEAYHWADN
YLTPGNRFQHTPDPESGAFYARIRHERYLNQQTRLNGETNCAALAPGQQLKVSGGEEVTDVWRQGVAIAA
IHCRARRDRSFVMTFQAIPCVETYCFRPAVISKPRMAGTLPARVTSTKINDLYGHIDRDGRYRVNLLFDR
DRWQPGEESLWVRQARPYAGETFGLHLPLLAGTEVAIAFEQGDPDRPYIAGALHDSTHQDHVTLYNYKRN
VLRTPANNKIRLDDTRGKEHVKVSTEYGGKSQLNLGHLVDHQNTPRGEGFELRTDSYGAIRGGKGIFITA
DEQLKAMGATVEMDPASQLLGSAVVQLNDWQEIARTHYNTPPDVSTLKQFVGKAVNLASPVLLMSAPKGI
GIVTAETTLLQSGKGLYLQSASDIALASGNRLSVNSKNAISLLSHREGMRMVSVKGPLEIESHGDTLALT
SLKEITVQSTQGHLQLTAKNGITLGCGGGYIRLTPQGEIHLHSPSLLSFKGTHKMQGPAGETFPLPDLPT
SICKDCLIRAQELAQAFVPRAA
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4706109-4703731 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAGTGACATAAAGCCTCTGTTGTTCAACCACAGCCATCATCTGTTACAGGTGCATGGTTGTAACTCGT
TGCTGGATGTTCTGTGCTTTGAAGGTGAGGAAAACTTAAGTGAGCCTTTCCGCTATACCATTGAATTTAC
CAGCAGCGATAAAGCTATCACCCCGCAGCAGATGTTGCTGCAAAACGCCTCGCTGACCTTGCAGGCGCCG
GTTGACCAGGGATTTGGCATTAAGATCCAGCAGCCGGTGCGCGTTCTTCAGGGAGTGATCACCTCTTTTG
AACGGCTTTCCATCGCAAAAGAGGAAACGCGCTACGCCTTGACGTTACAGCCGCGTCTGGCGCTACTGTC
GAAGAGTCATCAGAACCGTATTTATCAGGATATGTCGGCACCGCAGATTGTGGAGCACATTCTCAGAACC
CGTCACCAGATGCGCGGGGAAGATTTTGTCTTTCAACTGGCGCATGAATACCCGCAGCGTGAACAGGTGA
TGCAGTACGGCGAGGACGATCTGACCTTTATCTCCCGCCTGTTGGGTGAAGTGGGGATCTGGTTTCGCTT
TACCGCCGATACCCGGCTGAATATTGATGTGGCGGAGTTCTACGATGACCAGCAACACTACGAGACGGGA
CTGTTGTTGCCTTCGGTCGCTCCCTCCGGGCAGCATGACGGCGGGAACGAATCGGTGTGGGATTTACAGA
GCCGACACCACGTGGTTGAGCGTTCGGTGTTTACTCGTGACTATAACTACCGTAACGCGCCAGAGGATAT
GAATCTCAACGTCAATGTCAGCCGTGGCGATAGTACCACCTACGGTGAAGCCTATCACTGGGCGGACAAC
TATCTGACGCCGGGTAATCGCTTCCAGCATACTCCGGACCCGGAGAGCGGGGCCTTTTATGCCCGTATTC
GTCATGAGCGTTATCTCAACCAGCAGACGCGGCTGAATGGGGAAACCAACTGCGCGGCGCTGGCTCCCGG
CCAGCAGCTAAAAGTGAGCGGCGGCGAAGAGGTGACGGACGTCTGGCGACAGGGGGTGGCGATCGCTGCG
ATTCACTGCCGCGCCCGTCGCGACCGCAGCTTCGTCATGACGTTTCAGGCTATTCCCTGCGTAGAGACTT
ACTGCTTTCGCCCAGCGGTCATCAGCAAACCCAGAATGGCCGGGACGCTGCCGGCGCGCGTCACCAGCAC
CAAAATCAACGATCTCTATGGCCATATCGATCGCGACGGACGTTATCGGGTGAACTTATTGTTCGATCGC
GATCGCTGGCAGCCGGGTGAGGAAAGCCTGTGGGTGCGCCAGGCGCGCCCTTACGCCGGTGAAACCTTTG
GCCTGCATCTGCCGTTGTTAGCGGGCACCGAAGTGGCGATCGCTTTTGAGCAGGGGGATCCCGATAGGCC
CTATATTGCCGGCGCGCTGCACGACTCCACGCACCAGGACCACGTGACGCTCTACAACTACAAGCGTAAC
GTGCTGCGCACGCCGGCGAACAACAAGATTCGCCTCGATGATACACGGGGTAAAGAGCACGTTAAGGTCA
GCACCGAATATGGCGGCAAGAGCCAGCTCAACCTCGGTCATCTGGTGGATCATCAGAACACGCCGCGCGG
TGAGGGATTTGAGTTACGCACCGACAGCTACGGCGCGATCCGCGGCGGGAAGGGAATATTTATTACCGCC
GATGAACAGCTGAAAGCGATGGGCGCGACCGTGGAAATGGATCCCGCGAGTCAATTGCTCGGCAGTGCCG
TTGTTCAGCTCAACGACTGGCAGGAGATAGCCCGCACCCACTACAACACCCCGCCGGATGTCAGCACGTT
AAAGCAGTTCGTCGGCAAAGCCGTCAATCTGGCGAGCCCCGTCCTGCTGATGAGCGCGCCGAAAGGCATC
GGCATCGTGACGGCGGAAACGACGCTGCTACAGAGTGGTAAAGGGTTGTACCTGCAAAGCGCCAGCGATA
TTGCGCTGGCCAGCGGCAACCGGCTATCGGTGAATAGCAAAAACGCAATCTCGCTGCTTTCTCACCGCGA
AGGGATGCGTATGGTATCGGTGAAAGGACCGCTGGAAATAGAGTCGCACGGCGACACACTGGCGCTCACT
TCACTGAAGGAAATTACCGTTCAGTCAACGCAGGGACATCTGCAGCTTACCGCCAAAAATGGCATCACCC
TGGGCTGCGGCGGCGGCTACATCCGCCTGACGCCGCAGGGAGAAATCCATCTTCACAGCCCGAGTCTGCT
CAGTTTTAAAGGCACGCATAAGATGCAGGGGCCGGCCGGCGAGACGTTTCCGCTTCCCGATCTTCCCACA
TCGATATGTAAAGACTGCCTGATTCGTGCGCAAGAACTGGCTCAGGCTTTTGTGCCCCGCGCCGCCTGA
 Primer design