SecReT6
Protein ID: 336250866
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21990
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4706310..4707992 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDG0DZR9, G0DZR9
KEGG IDeae:EAE_21990
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.90E-16, Aligned region: 436..532
Protein Sequence: 560 a.a.     [Download]
>gi|336250866|ref|YP_004594576.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MSARYQRLLWLWGGLLAVLMILLFLPLSTGGRVLAVGLTAAGVAVGLVYVGRQQRERPADADWLVELPSA
PYRLPIVLVCGDTADWPGESAIYRTSQGCWLRVATAALQQTARYVRDERPALIAQLAVMFCMQPQQHDDD
AALAARLRELRWQLAQVRGDTRRAIPLLLNSSLSGASLEPLWQTARAGETLQVWLPDGVPCSSASWLMQA
DGAHRLAAQLRINALARFTQQIALSVLTAATDDVPPIAPAVVLYHFTPAGAPAVADNLWQHWLSEHTSLN
SLPGWLPEIAAEARKLPDFILPILPQGGGTTPKSRALRRAFCLFTLAALIALCCSAWNNQQLLQRVGFDV
QRYERTVMDDHAAKARAVQILRQDAAQLDAFARDGAPLALGLGLYRGERLRQPVLAAIRSYVPPPPPPKA
VEKIVPKIVRLDSMSLFDTGKWTLKPGSTKLLVNSLVGIKARPGWLIVIAGHTDSVGDDKSNQTLSLKRA
ESVRNWMRDTGDVPESCFAVQGYGESRPVASNDAQQGRALNRRVEISLVPQPDACQVSTNSASTSADGAF
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4707992-4706310 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAGCGCGCGCTATCAGCGCCTGCTCTGGCTGTGGGGCGGTCTGCTGGCGGTGTTGATGATCCTGCTGT
TTCTGCCGTTATCCACCGGCGGCCGGGTGCTGGCTGTTGGGTTGACGGCGGCGGGCGTAGCGGTCGGGCT
GGTCTACGTCGGGCGCCAACAACGTGAGCGACCTGCGGATGCCGACTGGCTGGTTGAGCTACCGTCGGCG
CCGTATCGACTGCCGATTGTGCTGGTCTGCGGCGACACGGCGGACTGGCCGGGAGAAAGCGCGATTTATC
GTACCTCACAGGGGTGCTGGCTGAGAGTCGCCACCGCCGCGTTGCAGCAGACGGCGCGTTATGTGCGCGA
TGAGCGCCCGGCGCTCATTGCGCAACTGGCGGTGATGTTCTGCATGCAGCCGCAACAACATGATGATGAC
GCGGCGCTGGCGGCGCGGCTACGCGAGTTGCGCTGGCAGCTTGCCCAGGTGCGGGGCGATACCCGTCGGG
CGATACCGTTACTGCTGAACAGCTCTCTGTCCGGCGCCTCGCTGGAACCGTTATGGCAGACAGCGCGTGC
CGGAGAGACGTTGCAGGTGTGGCTGCCTGACGGCGTGCCGTGCAGCAGCGCAAGCTGGTTGATGCAGGCT
GATGGCGCTCATCGCCTGGCGGCGCAGCTTAGGATAAATGCGCTTGCCCGCTTTACGCAGCAGATAGCGT
TGAGCGTACTGACGGCGGCCACCGACGATGTTCCCCCGATCGCTCCGGCGGTCGTACTGTATCATTTCAC
GCCAGCCGGGGCGCCTGCCGTGGCGGATAATCTATGGCAGCATTGGCTGTCTGAGCATACTTCCCTCAAC
TCACTACCGGGCTGGTTACCGGAAATTGCTGCAGAAGCGCGGAAACTGCCGGATTTCATTTTACCGATAC
TGCCGCAGGGCGGCGGCACCACGCCGAAAAGCCGTGCTCTGCGGCGGGCATTCTGTCTGTTCACCCTCGC
GGCCCTGATTGCGCTGTGCTGCAGCGCATGGAACAACCAGCAACTCCTCCAGCGGGTTGGCTTTGATGTT
CAGCGCTATGAACGGACGGTGATGGACGACCATGCCGCAAAAGCCCGCGCCGTACAGATTTTGCGTCAGG
ATGCGGCGCAACTGGATGCCTTCGCGCGTGATGGCGCGCCGCTGGCGCTGGGCCTTGGGCTCTATCGCGG
CGAGCGTCTGCGTCAGCCGGTACTGGCAGCGATTCGTTCCTACGTCCCTCCGCCTCCACCGCCGAAAGCG
GTAGAAAAAATCGTACCGAAAATTGTCCGTCTTGACAGCATGTCGCTATTCGACACCGGCAAGTGGACGC
TTAAACCGGGGTCCACCAAGCTGCTGGTGAACTCGCTGGTGGGGATCAAAGCCAGGCCCGGTTGGCTAAT
CGTCATCGCCGGACATACCGACAGCGTAGGCGATGATAAATCCAACCAGACACTCTCCCTGAAGCGTGCC
GAATCGGTGCGTAACTGGATGCGCGATACCGGCGACGTGCCGGAAAGCTGTTTTGCGGTGCAGGGTTATG
GCGAAAGCCGTCCGGTCGCCAGCAACGATGCGCAGCAAGGCCGGGCGCTGAACCGCCGGGTCGAAATTAG
CCTGGTGCCGCAGCCCGACGCCTGTCAGGTTTCGACGAACTCCGCTTCAACTTCGGCGGATGGCGCTTTC
TAA
 Primer design