SecReT6
Protein ID: 336250867
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_21995
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4707989..4708654 [-]
Producthypothetical protein
NoteTssL
UniProt IDG0DZS0
KEGG IDeae:EAE_21995
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-39, Aligned region: 7..208
Protein Sequence: 221 a.a.     [Download]
>gi|336250867|ref|YP_004594577.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MTQDINIDALLADSWLTVTELRLGAKLAEGEGKHLWQRCVDNIEQVMAQLVAADISEANRQHILYAWCAL
LDETAKGRNEEDDACIAWYDRPLEVKYFGGMEAGDALYERIRQVLREPAPDNLVLTCFHRVLALGFKGRY
GLNDPARAALVSALGERVPPFAGDPQQPILANLSGRRGLADWLRRWPISIGVSLVLVAALWLGLNYWLDG
LVAALRLGGGQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4708654-4707989 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGACCCAGGATATCAATATTGATGCTCTGCTGGCGGATAGCTGGCTAACGGTGACGGAACTGCGCCTTG
GCGCCAAACTGGCCGAGGGGGAGGGGAAACATCTCTGGCAGCGTTGTGTAGACAACATTGAACAGGTGAT
GGCGCAGTTGGTGGCCGCTGATATCAGCGAGGCGAACCGTCAGCATATCCTCTATGCATGGTGTGCGCTG
CTGGATGAAACCGCGAAAGGGCGCAATGAGGAAGATGACGCCTGTATCGCCTGGTACGATCGGCCGCTTG
AGGTTAAATATTTTGGCGGCATGGAAGCCGGAGATGCGCTCTATGAGCGCATCCGCCAGGTGCTGCGCGA
GCCGGCGCCGGATAACCTCGTTCTGACTTGTTTCCATCGGGTGTTGGCGCTGGGGTTTAAGGGGCGGTAT
GGCCTCAATGATCCGGCGCGCGCAGCGCTCGTCAGCGCGCTTGGCGAGCGGGTACCGCCGTTTGCGGGCG
ATCCTCAGCAGCCGATTCTGGCGAATCTATCCGGCCGCCGCGGTCTGGCAGACTGGTTGCGCCGTTGGCC
GATTAGTATTGGCGTGTCGCTGGTGCTGGTGGCCGCGTTGTGGTTGGGGTTGAACTACTGGCTGGATGGC
CTGGTCGCGGCGTTGCGACTGGGAGGCGGACAATGA
 Primer design