SecReT6
Protein ID: 336250868
SecReT6 ID449
T6SS typeN/A
Gene symbol-
Locus tagEAE_22000
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4708651..4709994 [-]
Producthypothetical protein
NoteTssK
UniProt IDG0DZS1
KEGG IDeae:EAE_22000
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-132, Aligned region: 18..444
Protein Sequence: 447 a.a.     [Download]
>gi|336250868|ref|YP_004594578.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MKTLRPLWGRGQMISPQHFQQQVNQAAWQSECIARLGVMNPWGIIRVEFDAALLKQGTLKASHLYVRFPD
GTLIDSDNADALPEVMVLPQAESRELTVVLALPHEHENGGNCLQMEQRAERPVRWRLAWREVRNRYGEDS
RQIAVMLAQLTLRTADDNNGDYQTVAVARLRRDSQDCWSLDENFIPPLLKVLASRWLHEQTEQLTNQLGV
RLQRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLNHFLRHPQVHPERLYEALASLAGSLLTFSL
DHTTADIPPYRHQALTEVFPPLFKLLGVLLEASLPSRVVAIEMTHDDRRKRWHARLHDPRLREEADFYLS
VRSALPAAQLLEQLPQQCKAGSPDEVDRVVNGSQPGIPLKAMSHVPAAIPLRLENQYFTLDMTHPAAQAM
LAEGSCVFYVPGLLGDPELELYAVLRS
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4709994-4708651 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGAAGACATTACGACCACTGTGGGGCAGGGGTCAGATGATCTCCCCACAACATTTTCAACAGCAGGTGA
ACCAGGCGGCCTGGCAAAGCGAATGTATCGCCCGTCTGGGGGTGATGAATCCCTGGGGGATCATCCGCGT
CGAATTTGACGCCGCATTGCTAAAACAGGGGACGCTGAAGGCCAGCCACCTCTATGTACGCTTCCCTGAT
GGAACGCTTATCGACAGCGATAACGCTGATGCGTTGCCTGAGGTCATGGTGTTGCCGCAAGCGGAAAGCC
GCGAATTAACGGTGGTGCTGGCGCTGCCTCATGAGCATGAAAACGGCGGCAACTGCCTGCAGATGGAACA
ACGCGCAGAGCGGCCGGTACGTTGGCGTTTGGCCTGGCGAGAAGTACGCAACAGATATGGCGAAGACAGT
CGACAAATTGCGGTGATGCTTGCGCAACTGACGCTGCGCACAGCGGATGACAATAACGGCGATTATCAAA
CCGTCGCCGTCGCCAGATTACGTCGCGACAGTCAGGATTGCTGGTCGTTGGATGAGAACTTTATCCCACC
GCTGCTGAAAGTGTTGGCCAGCCGCTGGCTGCACGAACAAACGGAACAGCTGACGAATCAACTGGGCGTG
CGCCTGCAACGCCTGATGGCCATGCGTAGGGAAAGCAACGCCAGGATGGCGGATTTTGCGGTAGCGGATG
TATCGCTGTTTTGGCTGCTGAACGCGCTTAACAGCGCGGAGCCGGTGTTGAACCATTTCCTGCGCCATCC
GCAGGTACATCCGGAACGGCTGTATGAAGCGCTGGCCAGCCTGGCGGGCAGCCTGTTGACCTTCTCCCTT
GACCATACCACGGCGGATATTCCGCCCTATCGCCATCAGGCGTTGACGGAAGTCTTTCCACCGCTGTTCA
AATTACTCGGCGTACTGCTCGAAGCCAGCCTGCCATCCCGGGTTGTGGCGATTGAAATGACGCACGATGA
CCGGCGTAAGCGCTGGCATGCCCGTCTGCACGATCCAAGGTTGCGCGAAGAGGCCGATTTTTATCTCTCG
GTGCGTTCCGCGCTACCTGCGGCGCAACTGCTGGAGCAGTTACCGCAACAGTGTAAAGCCGGTAGCCCCG
ATGAGGTTGACCGGGTGGTCAACGGTTCGCAGCCCGGCATTCCGCTGAAAGCCATGAGTCATGTTCCCGC
CGCCATCCCGCTGCGCCTGGAGAATCAGTATTTCACCCTTGATATGACTCATCCGGCGGCGCAGGCGATG
CTGGCGGAAGGGAGTTGCGTCTTTTACGTGCCCGGCCTGCTGGGCGACCCGGAACTCGAACTCTACGCGG
TGCTGCGCTCATGA
 Primer design