SecReT6
Protein ID: 338214576
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5207
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6052517..6053215 [-]
Productforkhead-associated protein
NoteFha
UniProt IDF8EIG4
KEGG IDrsi:Runsl_5207
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.80E-12, Aligned region: 111..197
Protein Sequence: 232 a.a.     [Download]
>gi|338214576|ref|YP_004658639.1| forkhead-associated protein [Runella slithyformis DSM 19594]
MEITCKKCKSRLKIINTGSPIVKCGNCGYPNPVVISPPKAGETNAPPAPATAKVAPPPSPFPPPNPNPRP
FVGGGLPHTPGAAPKSEPGWLVVHDENAPEQTHSLRVGRQVIGRLNTTAPCDIMITTQDVYMSRNHCILE
VKPGRTGGFDYLLSDRKMTNGAPELMSANGTYVNAFEKPLQPNDMVYLNDGDTIQIGQTKVVIKTIKTVA
NADDATRLVRDTDYTPTVIIKN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|338209545|ref|NC_015703.1|:c6053215-6052517 Runella slithyformis DSM 19594 chromosome, complete genome
ATGGAGATTACCTGTAAAAAGTGTAAATCACGGCTTAAGATTATCAACACCGGCAGTCCGATTGTTAAAT
GCGGCAATTGCGGGTATCCTAATCCGGTCGTTATCAGCCCTCCGAAAGCGGGAGAAACAAATGCGCCGCC
GGCACCGGCTACTGCCAAAGTGGCTCCGCCTCCGTCTCCTTTTCCACCGCCTAATCCCAACCCCAGGCCG
TTCGTGGGAGGCGGGTTGCCTCATACTCCCGGTGCGGCTCCCAAGAGTGAGCCGGGCTGGCTGGTGGTTC
ATGATGAAAATGCTCCCGAGCAGACCCACTCGCTGAGAGTCGGTCGGCAGGTGATCGGTCGTCTGAATAC
GACAGCTCCGTGTGATATCATGATCACCACTCAGGATGTGTATATGAGCCGTAATCACTGTATCCTTGAA
GTAAAGCCCGGTCGAACCGGAGGGTTTGATTATTTATTGTCAGATCGCAAAATGACCAACGGAGCGCCTG
AACTGATGAGTGCCAACGGAACCTATGTCAACGCTTTTGAAAAACCGCTTCAACCCAACGACATGGTCTA
TCTTAATGACGGTGATACCATTCAGATCGGACAAACCAAAGTAGTTATCAAAACGATCAAAACGGTCGCC
AACGCTGACGATGCCACTCGATTGGTACGAGATACGGACTACACACCCACCGTAATTATCAAAAATTAA
 Primer design