SecReT6
Protein ID: 338214579
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5210
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6055401..6056975 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDF8EIG7
KEGG IDrsi:Runsl_5210
PDB IDNA
Domain hit(s) vs Pfam VWA_2 [PF13519], Evalue: 2.10E-21, Aligned region: 301..468
VWA [PF00092], Evalue: 1.20E-14, Aligned region: 301..460
PKD [PF00801], Evalue: 1.90E-09, Aligned region: 61..120
PKD [PF00801], Evalue: 1.90E-09, Aligned region: 227..249
Protein Sequence: 524 a.a.     [Download]
>gi|338214579|ref|YP_004658642.1| PKD domain-containing protein [Runella slithyformis DSM 19594]
MDKSYPKTMNSTLHILRLFTGFCRQRGGILLLSLFWIFCPEGCKQKEPLPEPIADFSYTPGQNLEAPVTI
TFMNNSQNADSFEWDFDDGTGSTLRNPVKRFTKGGTYTVTLTAKGGGGTRTAFATIVIEENLYGGNNGKI
GFWSKIGNEGFTSITINTGTQTLKSYWAATPDCTNGSLASFTLPAGDYSFVAVNDEGRRWKGSIRVTRAQ
CALWELKKEEGIVSLPSGAVIRSTATSRSGQTIRFTLDIAMVNGDNSLSGNLSRSDFSIGGFSSNGVNYS
FVNEGIQVLSGGPNVPYSASLLLDQSGSISGTDPQNHRIEAAKVFCQSLGQGDNVHLSAFASAGKIPYEL
TVYGNGFNSNGSVYLGTLDNLKNQIGGGTPLCKSTYSMIDYVSKNAPNQNKALVVFTDGEDTGGGRTPDD
IIKLARQLNIKVFMMGLGTAEVQNLAYIANQTGGAFMFAREAPQLMTMFGSLGKLLNGTANYYRTSWTMT
RSPGVGTSGSYWVTSSVQVKIGGRTVFVPFRVDY
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|338209545|ref|NC_015703.1|:c6056975-6055401 Runella slithyformis DSM 19594 chromosome, complete genome
ATGGATAAGTCATACCCGAAAACCATGAATTCTACATTACACATTCTTCGGCTTTTTACAGGTTTTTGCA
GGCAAAGAGGAGGGATATTGTTGCTGTCGCTTTTTTGGATATTCTGCCCGGAAGGCTGTAAGCAGAAAGA
GCCGCTTCCGGAGCCGATCGCAGATTTTTCATACACTCCCGGACAAAACCTCGAAGCGCCGGTCACTATT
ACATTTATGAACAATTCTCAAAATGCCGATTCATTTGAGTGGGATTTTGATGACGGCACCGGCTCGACAC
TCCGAAATCCCGTGAAGAGATTTACAAAGGGGGGTACGTATACGGTTACCTTAACGGCAAAAGGGGGAGG
GGGAACCCGGACTGCATTTGCGACGATCGTGATTGAGGAGAATCTATACGGTGGAAATAACGGGAAAATT
GGGTTTTGGTCTAAGATCGGAAATGAAGGGTTTACTTCCATTACCATTAATACCGGCACCCAAACGCTTA
AAAGTTATTGGGCAGCTACGCCTGACTGTACCAATGGCAGTTTGGCAAGTTTTACGCTGCCGGCGGGAGA
TTACAGCTTCGTGGCAGTCAATGATGAGGGGCGTCGTTGGAAAGGGTCAATCAGAGTAACAAGGGCACAA
TGTGCTTTGTGGGAGTTGAAGAAAGAGGAAGGTATTGTTTCATTGCCTTCCGGAGCGGTTATCCGTTCAA
CGGCCACTTCACGCAGTGGGCAGACCATTCGGTTTACTCTGGATATTGCCATGGTAAATGGCGATAACTC
ACTTAGCGGCAACTTGTCAAGGTCAGATTTTTCCATTGGCGGCTTTTCTTCAAACGGGGTTAATTATTCA
TTTGTAAATGAGGGAATACAGGTGCTTTCCGGTGGACCGAATGTGCCTTATTCTGCTTCACTGCTGCTGG
ACCAAAGCGGCAGTATATCAGGGACTGATCCCCAAAACCATCGCATTGAAGCGGCCAAAGTGTTTTGTCA
ATCGCTGGGACAGGGTGACAATGTACATCTGAGCGCATTTGCAAGTGCGGGCAAGATTCCGTATGAATTA
ACCGTGTATGGAAATGGATTTAATTCAAACGGCAGTGTTTATTTAGGAACATTAGACAACCTGAAAAATC
AGATAGGAGGAGGAACACCGCTGTGTAAGTCAACCTATTCAATGATCGACTATGTCAGTAAAAATGCCCC
CAATCAAAATAAGGCGTTGGTGGTTTTTACCGACGGTGAAGATACAGGCGGGGGCAGAACGCCGGACGAT
ATCATCAAGCTTGCCAGACAGTTAAACATAAAAGTATTTATGATGGGTTTGGGGACCGCGGAAGTTCAAA
ACCTGGCCTACATTGCCAATCAGACGGGAGGGGCATTTATGTTTGCAAGAGAGGCACCACAGTTGATGAC
AATGTTTGGCTCTCTTGGAAAATTGCTGAACGGAACGGCAAACTATTATCGAACGTCCTGGACCATGACC
CGTAGCCCGGGCGTAGGTACTTCGGGATCGTATTGGGTCACCAGTTCGGTACAGGTAAAGATTGGGGGCC
GAACCGTTTTTGTCCCTTTCAGAGTAGATTATTAG
 Primer design