SecReT6
Protein ID: 338214580
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5211
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6057176..6059680 [+]
ProductATPase AAA
NoteClpV
UniProt IDF8EIG8
KEGG IDrsi:Runsl_5211
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-49, Aligned region: 208..288
AAA_2 [PF07724], Evalue: 2.00E-49, Aligned region: 566..728
AAA [PF00004], Evalue: 8.40E-21, Aligned region: 211..340
AAA [PF00004], Evalue: 8.40E-21, Aligned region: 572..665
ClpB_D2-small [PF10431], Evalue: 3.10E-19, Aligned region: 735..813
AAA_5 [PF07728], Evalue: 1.00E-15, Aligned region: 210..236
AAA_5 [PF07728], Evalue: 1.00E-15, Aligned region: 570..688
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 189..232
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 254..306
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 461..485
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 539..606
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 634..665
AAA_22 [PF13401], Evalue: 3.30E-12, Aligned region: 207..305
AAA_22 [PF13401], Evalue: 3.30E-12, Aligned region: 333..395
AAA_22 [PF13401], Evalue: 3.30E-12, Aligned region: 568..594
Sigma54_activat [PF00158], Evalue: 1.10E-09, Aligned region: 190..291
Sigma54_activat [PF00158], Evalue: 1.10E-09, Aligned region: 571..677
IstB_IS21 [PF01695], Evalue: 1.60E-07, Aligned region: 207..332
IstB_IS21 [PF01695], Evalue: 1.60E-07, Aligned region: 571..589
AAA_14 [PF13173], Evalue: 3.90E-07, Aligned region: 208..293
AAA_14 [PF13173], Evalue: 3.90E-07, Aligned region: 572..664
NACHT [PF05729], Evalue: 5.90E-07, Aligned region: 211..289
NACHT [PF05729], Evalue: 5.90E-07, Aligned region: 572..591
AAA_18 [PF13238], Evalue: 9.20E-07, Aligned region: 211..315
AAA_18 [PF13238], Evalue: 9.20E-07, Aligned region: 572..588
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 209..234
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 380..414
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 572..592
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 792..814
AAA_17 [PF13207], Evalue: 2.60E-06, Aligned region: 211..275
AAA_17 [PF13207], Evalue: 2.60E-06, Aligned region: 571..605
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 210..230
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 323..359
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 569..620
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 185..228
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 565..644
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 786..815
AAA_10 [PF12846], Evalue: 1.80E-05, Aligned region: 209..227
AAA_10 [PF12846], Evalue: 1.80E-05, Aligned region: 274..298
AAA_10 [PF12846], Evalue: 1.80E-05, Aligned region: 569..592
AAA_25 [PF13481], Evalue: 4.20E-05, Aligned region: 211..294
AAA_25 [PF13481], Evalue: 4.20E-05, Aligned region: 570..616
AAA_33 [PF13671], Evalue: 0.00012, Aligned region: 211..358
AAA_33 [PF13671], Evalue: 0.00012, Aligned region: 571..588
RNA_helicase [PF00910], Evalue: 0.00028, Aligned region: 211..233
RNA_helicase [PF00910], Evalue: 0.00028, Aligned region: 571..592
Mg_chelatase [PF01078], Evalue: 0.00036, Aligned region: 206..234
Mg_chelatase [PF01078], Evalue: 0.00036, Aligned region: 570..593
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 210..292
RuvB_N [PF05496], Evalue: 0.00046, Aligned region: 535..589
ABC_tran [PF00005], Evalue: 0.00056, Aligned region: 210..237
ABC_tran [PF00005], Evalue: 0.00056, Aligned region: 572..608
MobB [PF03205], Evalue: 0.00057, Aligned region: 210..234
MobB [PF03205], Evalue: 0.00057, Aligned region: 572..596
Clp_N [PF02861], Evalue: 0.00073, Aligned region: 17..47
Clp_N [PF02861], Evalue: 0.00073, Aligned region: 96..115
AAA_29 [PF13555], Evalue: 0.00083, Aligned region: 207..244
AAA_29 [PF13555], Evalue: 0.00083, Aligned region: 569..583
AAA_24 [PF13479], Evalue: 0.0013, Aligned region: 210..229
AAA_24 [PF13479], Evalue: 0.0013, Aligned region: 574..592
NTPase_1 [PF03266], Evalue: 0.0016, Aligned region: 210..233
NTPase_1 [PF03266], Evalue: 0.0016, Aligned region: 268..288
NTPase_1 [PF03266], Evalue: 0.0016, Aligned region: 570..593
AAA_28 [PF13521], Evalue: 0.0019, Aligned region: 211..231
AAA_28 [PF13521], Evalue: 0.0019, Aligned region: 571..589
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 190..226
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 265..317
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 573..591
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 634..652
ResIII [PF04851], Evalue: 0.0043, Aligned region: 206..225
ResIII [PF04851], Evalue: 0.0043, Aligned region: 267..295
ResIII [PF04851], Evalue: 0.0043, Aligned region: 569..588
PhoH [PF02562], Evalue: 0.0044, Aligned region: 191..224
PhoH [PF02562], Evalue: 0.0044, Aligned region: 405..459
PhoH [PF02562], Evalue: 0.0044, Aligned region: 571..591
AAA_23 [PF13476], Evalue: 0.0065, Aligned region: 207..228
AAA_23 [PF13476], Evalue: 0.0065, Aligned region: 569..595
AAA_3 [PF07726], Evalue: 0.0081, Aligned region: 211..232
AAA_3 [PF07726], Evalue: 0.0081, Aligned region: 641..667
Torsin [PF06309], Evalue: 0.0085, Aligned region: 527..594
Protein Sequence: 834 a.a.     [Download]
>gi|338214580|ref|YP_004658643.1| ATPase AAA [Runella slithyformis DSM 19594]
MISTQLNDELIRAIQIAQAIAKEHQQGVYAPAHLLKGLLHNDVGLGALLVGWEIDINYLRDWADYRIEKL
PKSARGTLDMRPDPKTVAALEVADIIRLKLGDSSLSPLAVLIAITRPEVAYTKDQLKSFPITETELLTFA
LQNIQAETTLSPASDEPSRAGGGNASFQALLKYCVDKTALARQGKLDPIIGRDKETRTMVEILGRRSKPN
VIIVGEPGVGKTALVEGLARLIIAGQVPAHLQKAALFQLDMGALIAGASYKGEIEDRLKNIIAEVKRHER
ALLFIDEIHVLMDPQSGAMGLVNLLKPELARGELTVIGATTLDEFRKFMEPDEAFSRRFELVRVDEPDET
TASRMVGRVVPLFEEHHQIKVGQGTVVETVRLARRYIKDRRLPDAAIDLIDRTMAAMKLMTETTQQEIDL
LRTELTELREEHAGGDPILYNQELRWFERQLRHRLSPILLGQLEEDTQLAQMELPEAVAELLTELLIRLQ
TLGGQRKETVETHDVAAVVAHKTGIPLGKLQSTEREKLLQLNEHLKKRVVGQDHATKVIADAILENRSGL
SRPGQPIGSFFFSGPTGTGKTELAKTMADFLFNDEKALIRFDMSEFKEEHSAAVLYGAPPGYVGYEEGGL
LVTKIRQQPFAIVLFDEIEKAHPSVFDLFLQILDEGTLHDRLGREGDFSNAIILFTSNIGSEWIAGQFGQ
GQIPASNDILDLMTKHFRPEFLGRLTEIIPFSPITESAVLNIFNIQLKPLIVLLEKQGITLNIDDEARKA
LALEGFTPKYGARPIRGVIRNRIRRPLSRMIVAGEIGKGSTVTLKLGKDGEFDWENEPIIETIH
 
Nucleotide Sequence: 2505 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6057176-6059680 Runella slithyformis DSM 19594 chromosome, complete genome
ATGATTTCTACACAATTGAACGACGAACTCATAAGGGCTATTCAGATAGCACAGGCCATTGCGAAAGAAC
ACCAACAGGGAGTGTATGCGCCGGCTCATTTACTGAAAGGGCTGCTGCACAACGACGTCGGCTTGGGAGC
GCTGCTTGTCGGTTGGGAAATTGATATTAATTATCTCAGGGATTGGGCCGATTATCGTATTGAAAAGCTA
CCCAAATCAGCACGCGGTACGCTGGATATGCGTCCTGATCCGAAAACAGTTGCCGCGCTTGAAGTAGCGG
ATATTATTCGACTGAAACTGGGAGATTCGAGCCTTTCGCCCTTAGCGGTCCTGATTGCCATTACCCGCCC
GGAAGTGGCTTATACAAAAGACCAACTCAAATCTTTTCCGATTACAGAGACCGAGCTGCTGACGTTTGCG
CTTCAAAATATACAGGCAGAAACCACGCTAAGCCCTGCTTCCGACGAACCTTCCCGGGCCGGCGGCGGCA
ATGCCTCATTTCAGGCCCTGCTCAAATACTGCGTCGACAAAACCGCCCTGGCCCGTCAGGGGAAACTTGA
CCCGATCATCGGCCGCGACAAAGAAACCCGTACCATGGTCGAGATCCTCGGGCGACGCTCCAAGCCCAAC
GTCATCATCGTAGGCGAGCCGGGCGTAGGAAAAACCGCCCTCGTCGAAGGCCTCGCCCGGCTCATCATCG
CCGGGCAGGTGCCCGCCCATTTGCAGAAAGCCGCCCTGTTTCAACTCGACATGGGGGCCCTCATTGCCGG
TGCTTCCTACAAAGGAGAGATCGAAGACCGCCTTAAAAATATCATTGCCGAAGTCAAACGGCACGAACGC
GCCCTTTTGTTCATCGACGAGATCCACGTCCTGATGGACCCCCAAAGCGGAGCCATGGGGCTGGTCAACC
TGCTCAAACCCGAACTGGCCCGCGGGGAGCTGACCGTCATCGGCGCCACCACCCTCGACGAGTTCCGTAA
ATTCATGGAACCCGACGAAGCCTTCAGCCGACGTTTTGAACTCGTCAGGGTCGACGAGCCCGACGAGACC
ACGGCGAGTCGCATGGTGGGCAGGGTCGTACCGCTCTTTGAAGAACATCACCAAATCAAAGTGGGCCAAG
GCACCGTTGTCGAAACCGTGCGCCTGGCCCGTAGATACATCAAGGACCGTCGCCTGCCCGATGCCGCCAT
TGACCTCATTGACCGCACCATGGCGGCCATGAAGCTCATGACCGAAACCACGCAGCAGGAAATCGATCTG
CTGCGCACGGAACTCACCGAGCTGCGGGAAGAACACGCAGGCGGCGATCCGATACTATACAATCAGGAAC
TGCGCTGGTTTGAACGTCAACTGCGGCACCGCCTCAGCCCGATCCTGTTGGGGCAGTTGGAAGAAGATAC
GCAATTGGCACAAATGGAACTGCCCGAAGCCGTGGCCGAGTTGCTGACGGAGCTGCTGATCCGGCTCCAA
ACACTGGGAGGACAGCGCAAAGAGACGGTCGAAACGCACGATGTGGCCGCCGTCGTCGCCCACAAAACGG
GCATTCCGCTGGGCAAGCTGCAATCTACCGAGCGGGAGAAACTCCTGCAACTCAACGAACACCTCAAAAA
ACGGGTGGTCGGACAGGATCATGCCACCAAAGTCATTGCCGATGCCATTCTGGAAAACCGCTCGGGGCTG
AGCCGTCCGGGGCAGCCCATCGGTTCGTTTTTCTTCTCGGGCCCGACAGGCACGGGCAAGACGGAATTGG
CCAAAACGATGGCGGATTTTCTGTTCAACGACGAAAAAGCCCTGATTCGATTCGACATGTCGGAGTTTAA
GGAGGAGCATTCAGCGGCGGTACTGTACGGGGCGCCTCCGGGCTACGTGGGGTATGAGGAGGGCGGTTTG
CTGGTGACCAAAATCAGGCAGCAGCCCTTTGCCATTGTGTTGTTTGACGAAATTGAAAAAGCGCACCCTT
CGGTCTTTGACCTGTTTTTACAGATCCTCGACGAGGGCACCCTGCACGATCGATTGGGGCGCGAGGGAGA
TTTCAGCAATGCCATCATTTTGTTTACGTCCAATATCGGCTCCGAGTGGATCGCAGGGCAGTTCGGGCAG
GGGCAAATCCCCGCTTCCAATGACATTCTGGACCTGATGACCAAGCACTTCCGTCCCGAGTTTTTGGGAC
GCCTGACGGAGATCATTCCCTTCAGCCCGATCACGGAGAGTGCGGTGCTCAACATTTTCAACATTCAGCT
TAAGCCGTTGATTGTCTTACTGGAAAAACAGGGTATTACGCTCAATATAGATGACGAAGCGCGCAAAGCC
TTAGCCCTGGAAGGTTTTACGCCCAAGTACGGGGCGCGTCCGATCCGGGGCGTGATCCGTAACCGCATCC
GTCGGCCGCTCTCACGGATGATCGTGGCGGGAGAAATCGGCAAGGGAAGCACCGTGACACTGAAATTGGG
AAAAGACGGAGAATTTGATTGGGAGAACGAGCCAATTATAGAAACAATACATTAA
 Primer design