SecReT6
Protein ID: 338214582
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5213
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6060683..6061138 [+]
Producthypothetical protein
NoteTssB
UniProt IDF8EIH0
KEGG IDrsi:Runsl_5213
PDB IDNA
Domain hit(s) vs Pfam DUF713 [PF05218], Evalue: 0.0071, Aligned region: 47..140
Protein Sequence: 151 a.a.     [Download]
>gi|338214582|ref|YP_004658645.1| hypothetical protein [Runella slithyformis DSM 19594]
MAIEKPQLGGVVIDEGTSEAIKLLHDNKTAIISKFTADSLSQEPVEGIQKLQDAFDHFQPQVDISHTTEE
GQEVNETLNFTNMTAFTVKGMIEQSGYLQELKGKEDDYQTLIKRLMTNKVFQKLLADPAGKAAFVEALNA
MIAELDEVDGE
 
Nucleotide Sequence: 456 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6060683-6061138 Runella slithyformis DSM 19594 chromosome, complete genome
ATGGCAATCGAAAAACCCCAATTAGGCGGCGTCGTCATCGACGAAGGAACCAGCGAAGCCATCAAGCTGC
TTCACGACAACAAAACGGCCATCATCAGCAAATTCACCGCTGACTCCCTGAGCCAGGAGCCCGTGGAAGG
TATCCAAAAATTGCAGGATGCCTTTGATCATTTTCAGCCTCAGGTAGACATAAGTCATACCACCGAAGAG
GGACAGGAGGTCAACGAGACGCTCAACTTTACGAACATGACGGCCTTTACGGTCAAAGGCATGATCGAGC
AAAGCGGCTACCTGCAGGAGTTGAAAGGCAAAGAAGATGACTATCAAACCCTGATCAAACGCCTGATGAC
CAACAAGGTTTTTCAAAAATTGCTGGCCGACCCCGCCGGCAAAGCGGCCTTTGTGGAAGCCCTCAACGCC
ATGATTGCCGAATTGGACGAGGTTGACGGTGAATAA
 Primer design