SecReT6
Protein ID: 338214583
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5214
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6061192..6062565 [+]
Producthypothetical protein
NoteTssC
UniProt IDF8EIH1
KEGG IDrsi:Runsl_5214
PDB IDNA
Domain hit(s) vs Pfam Phage_sheath_1 [PF04984], Evalue: 9.00E-10, Aligned region: 273..445
DUF877 [PF05943], Evalue: 3.80E-08, Aligned region: 111..242
DUF877 [PF05943], Evalue: 3.80E-08, Aligned region: 299..440
Protein Sequence: 457 a.a.     [Download]
>gi|338214583|ref|YP_004658646.1| hypothetical protein [Runella slithyformis DSM 19594]
MPLEEQAPQSKELVREKAAPSQAAPRPLTLIVPQLTKYGGFEFIKTIVDGTDNMDPAKKARKAMFLEEEE
NQADRQKLKKRLQAVADLLSAHDNVADMIAEAEQKAASASETLKANLRNCLAQTEELERSYRSLALFFEN
TAEEKVKNLVLFDAGLEHTTDTDGFSNPTGIFEQVAKELRDNYDRFDLTNNYSLIVLPGWLKKNIIVDKW
AELAHQNKVMMITDYRHLDSAEDVEAMFDRDKLTGSDAHKAHVMMPCNWVVGREANTDIGEEDHLFIPPS
MALAGLLWGGNIAQPSAGLAHGKLKMASGTRFTMRKNEVAQLENKGLIPLIYEWGRVVPQSAKTLFDGDN
VGLQTYSVVRVFDWIGKIMQDFLNRRTFENIDNRMLEDIKRQISKFLAEIRGPGKIIEDYRNLEVKRNPD
KPTHVIINVDLKPFFPAKVFAINMTGTKGNWDSELKP
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6061192-6062565 Runella slithyformis DSM 19594 chromosome, complete genome
ATGCCTTTGGAAGAACAAGCCCCTCAATCGAAAGAACTTGTGCGGGAAAAAGCCGCGCCGAGTCAGGCCG
CGCCCCGTCCTTTGACCCTGATCGTTCCGCAACTCACCAAATACGGCGGCTTTGAATTTATCAAAACCAT
CGTCGACGGTACCGATAACATGGACCCCGCCAAAAAGGCCCGCAAGGCCATGTTTTTGGAAGAGGAAGAA
AATCAAGCCGATCGCCAAAAACTCAAAAAGCGCCTCCAGGCCGTCGCTGACCTGCTTTCCGCCCACGATA
ACGTGGCCGATATGATCGCCGAGGCCGAACAGAAAGCCGCTTCGGCAAGCGAAACCCTCAAGGCCAATCT
GCGTAACTGCCTGGCCCAGACCGAAGAACTCGAACGCTCGTATCGCTCTCTGGCCCTTTTCTTTGAAAAT
ACGGCCGAAGAAAAGGTAAAAAACCTCGTGCTGTTTGATGCCGGTTTGGAGCATACCACCGATACCGACG
GCTTCAGCAATCCGACGGGCATCTTTGAGCAGGTGGCCAAAGAACTCCGCGACAATTACGACCGCTTCGA
CCTGACCAACAATTATTCGCTGATCGTACTGCCCGGCTGGTTGAAGAAGAATATCATCGTCGATAAATGG
GCCGAATTGGCCCACCAAAACAAGGTCATGATGATCACCGATTATCGTCACCTCGACAGCGCCGAAGACG
TGGAAGCCATGTTTGACCGCGATAAACTGACGGGCTCCGATGCGCACAAAGCCCACGTGATGATGCCCTG
CAACTGGGTGGTAGGTCGCGAAGCCAATACCGACATCGGCGAAGAAGACCACCTGTTCATTCCGCCCTCG
ATGGCCCTGGCAGGCTTGCTTTGGGGGGGCAACATCGCCCAGCCGTCGGCAGGCCTGGCGCACGGAAAAC
TCAAAATGGCCAGTGGTACGCGCTTCACCATGCGCAAGAACGAAGTGGCGCAGTTGGAGAACAAGGGCCT
GATCCCGCTGATCTATGAGTGGGGGCGGGTGGTGCCGCAATCGGCCAAAACGCTCTTTGACGGCGACAAC
GTCGGCCTGCAAACGTACAGTGTGGTGCGTGTGTTTGATTGGATCGGCAAGATCATGCAGGATTTCCTGA
ACCGCCGCACGTTTGAAAACATCGACAACAGGATGCTGGAAGACATCAAAAGGCAGATCTCGAAGTTTCT
GGCTGAGATTCGCGGACCCGGCAAGATCATCGAAGATTACCGCAATCTGGAAGTGAAAAGAAACCCGGAC
AAACCGACGCACGTCATCATCAATGTGGACCTGAAGCCCTTTTTCCCCGCCAAAGTATTTGCCATCAACA
TGACAGGTACCAAAGGCAACTGGGATTCGGAACTTAAACCGTAA
 Primer design