SecReT6
Protein ID: 338214584
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5215
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6062606..6062998 [+]
Producthypothetical protein
NoteHcp
UniProt IDF8EIH2
KEGG IDrsi:Runsl_5215
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 130 a.a.     [Download]
>gi|338214584|ref|YP_004658647.1| hypothetical protein [Runella slithyformis DSM 19594]
MAHKAEITIDSKKFEVLHCSYSLHQHVNPNTNETTSEVFGGNIDVTIETRNADAKIIELMVLPHKDDVSG
EIKFNNQKGEELRTIKFNHAAVVNFSETFSLSGSGTGSQSFTICARELDIQGQKLNLKRD
 
Nucleotide Sequence: 393 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6062606-6062998 Runella slithyformis DSM 19594 chromosome, complete genome
ATGGCACATAAGGCAGAAATTACCATTGACAGTAAAAAATTTGAAGTATTGCACTGCTCGTACAGCTTAC
ATCAGCATGTAAACCCCAATACCAACGAGACAACCTCCGAAGTATTCGGCGGCAACATTGATGTTACCAT
CGAAACACGCAATGCCGACGCCAAAATCATTGAACTGATGGTATTACCGCACAAAGATGACGTCAGCGGA
GAAATCAAGTTCAACAATCAGAAAGGCGAAGAGCTGAGAACCATCAAGTTCAACCACGCCGCCGTGGTCA
ATTTCAGCGAAACCTTCAGCCTTTCGGGCAGCGGCACGGGCTCACAGAGTTTCACCATCTGCGCCCGTGA
GTTGGACATCCAGGGGCAGAAACTGAACCTAAAAAGAGATTAG
 Primer design