SecReT6
Protein ID: 338214586
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5217
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6064212..6066005 [+]
ProductRhs element Vgr protein
NoteVgrG
UniProt IDF8EIH4
KEGG IDrsi:Runsl_5217
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-23, Aligned region: 50..350
Phage_base_V [PF04717], Evalue: 1.40E-18, Aligned region: 174..186
Phage_base_V [PF04717], Evalue: 1.40E-18, Aligned region: 387..465
Sarcoglycan_1 [PF04790], Evalue: 0.0064, Aligned region: 516..567
Protein Sequence: 597 a.a.     [Download]
>gi|338214586|ref|YP_004658649.1| Rhs element Vgr protein [Runella slithyformis DSM 19594]
MPSTIQLLAAVEININGLTLKRISSISISQPFENHHTFEISISPDMLPEKSTTIDLKKLAEQVVGEVAVI
KLKQGQKQEDGSIQEKQTRTFKGIATTIRLNKGSSTSNTIVISGVSNTAVLSAGRTTRSFTDKSLGDIVQ
KVLSPFGGLSKKIAPSYTSPIRYVTQYEEDNFHFLQRLAEEYGEWMFYDGEQFVFGKSGRDKGSEVTLKH
GENIFDMQYSLRVTPLNLKGLNYDYYNHLTYEAPSSGENVSGLGTFAMVGLHKSDAVFSDEPVEIGYQNH
REKSTLKKAVRLKKSEQANKLAVLTGRTPEMELKLGGIVKVVDTYVNDQNKAEVIDYGSFVVTRLSHYLD
TRGVYQCHFEAVPQDTDFAPADYRILSPNAEPQPAVVMQVDDKDSMGRVKVQFPWQKNDNEITPWIRVVH
PMAARDRGMYFIPEIDEVVFVDFEFGNPDVPFVTGSMYHGQAKPGDLFEAKNNIKGIITKGGNHIIIDDT
DGKEKIKIYNRESKNEIELSIDGEASIKAKSNGTIYLEAAKGIEMKAPKITMEADNEVDINAGNSVKVEG
MTVDVNAQASGSFKTSAQLELNGGSMAVLKAAMVMIN
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6064212-6066005 Runella slithyformis DSM 19594 chromosome, complete genome
ATGCCCTCAACCATACAACTCCTTGCGGCTGTAGAGATCAATATAAATGGACTGACGCTTAAACGTATCA
GCAGTATTTCCATTTCACAGCCTTTTGAAAATCACCATACCTTCGAGATAAGCATATCGCCGGATATGTT
GCCGGAGAAATCGACAACCATCGATCTGAAAAAACTGGCGGAGCAAGTGGTCGGTGAGGTTGCGGTTATC
AAATTAAAGCAGGGACAAAAACAGGAAGACGGCAGTATTCAGGAAAAGCAAACCCGTACCTTTAAGGGCA
TTGCCACCACCATTCGTTTGAATAAAGGCAGCAGCACCTCCAATACCATTGTTATTTCGGGCGTCAGCAA
TACCGCGGTACTGAGCGCCGGACGCACTACACGCTCCTTTACGGACAAATCCCTCGGTGATATTGTCCAA
AAAGTATTGAGTCCTTTTGGCGGGCTTTCCAAAAAAATAGCGCCTTCCTACACCTCCCCCATTCGCTATG
TAACACAGTATGAAGAAGATAACTTTCATTTTCTGCAACGTTTGGCCGAAGAATATGGTGAGTGGATGTT
TTACGACGGCGAGCAGTTTGTATTCGGCAAAAGCGGGAGGGATAAAGGCAGTGAGGTAACGCTTAAACAC
GGAGAGAACATTTTCGATATGCAGTACAGCCTTCGGGTCACACCGCTCAACCTCAAAGGCCTCAATTATG
ATTATTACAACCATTTAACCTACGAAGCGCCTTCATCGGGCGAAAATGTAAGCGGTTTGGGTACGTTTGC
CATGGTGGGTCTGCATAAATCCGATGCTGTATTCAGTGACGAGCCTGTTGAGATCGGCTACCAAAACCAC
CGTGAAAAAAGCACATTGAAAAAAGCCGTCCGGTTAAAGAAAAGCGAGCAGGCCAACAAACTGGCCGTCC
TTACCGGCCGAACTCCCGAAATGGAACTGAAATTGGGCGGCATTGTCAAAGTGGTCGATACCTACGTGAA
TGACCAAAACAAAGCGGAAGTTATTGACTATGGGTCGTTTGTGGTCACGCGTTTGAGTCATTATCTGGAT
ACAAGAGGAGTATATCAATGCCACTTTGAGGCCGTACCGCAGGATACGGACTTTGCTCCGGCAGATTACC
GCATCCTTTCCCCCAACGCCGAACCTCAACCGGCCGTAGTAATGCAGGTGGATGACAAAGACAGCATGGG
CCGGGTAAAAGTACAGTTTCCCTGGCAAAAGAATGACAATGAGATCACTCCCTGGATACGGGTTGTCCAT
CCGATGGCAGCCCGGGATCGCGGAATGTACTTTATCCCCGAAATAGACGAAGTGGTGTTTGTGGATTTTG
AATTCGGCAACCCCGATGTGCCGTTTGTCACGGGCAGTATGTACCATGGCCAAGCCAAACCCGGAGACCT
GTTTGAGGCAAAGAACAACATCAAGGGAATCATTACCAAAGGGGGAAATCATATCATTATTGATGATACC
GACGGCAAAGAGAAAATCAAAATCTATAACCGGGAAAGTAAAAATGAAATCGAACTGTCCATCGACGGCG
AGGCCAGCATAAAAGCCAAAAGCAACGGCACCATTTATCTGGAAGCCGCCAAGGGGATTGAAATGAAAGC
CCCGAAAATTACAATGGAAGCGGATAACGAGGTGGATATCAATGCCGGAAACAGCGTCAAAGTCGAGGGC
ATGACCGTAGATGTAAATGCGCAGGCTTCGGGGTCGTTCAAAACCTCCGCTCAGCTCGAATTGAATGGAG
GCAGCATGGCAGTCTTAAAAGCCGCAATGGTCATGATAAACTAG
 Primer design