SecReT6
Protein ID: 338214588
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5219
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6066551..6067174 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDF8EIH6
KEGG IDrsi:Runsl_5219
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-11, Aligned region: 30..42
GPW_gp25 [PF04965], Evalue: 3.20E-11, Aligned region: 90..194
Protein Sequence: 207 a.a.     [Download]
>gi|338214588|ref|YP_004658651.1| GPW/gp25 family protein [Runella slithyformis DSM 19594]
MSEPFYPIPPSFGALMKPQGAERNFVEELKTLHTYEEAIKRFGGEKKLQEFPLIDKLLKSFSLSSFSELK
QKLPFQELIDYLAEETIVQKITVEESIIQNINLYLSSKPKEFYFDREYGCIVHNYDFRQLNDTPSKDQLK
RTISDYLQKFEKRITVNTVSIEINDVQESVEGSHPRICRYITITIAGILVQTQERLREMKFRLVRYT
 
Nucleotide Sequence: 624 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6066551-6067174 Runella slithyformis DSM 19594 chromosome, complete genome
ATGTCTGAGCCGTTTTATCCTATTCCCCCCTCTTTCGGTGCCCTGATGAAACCACAGGGCGCCGAAAGAA
ACTTTGTAGAAGAACTCAAGACGCTGCATACGTATGAGGAAGCCATAAAACGATTTGGGGGTGAGAAAAA
ACTGCAGGAATTTCCGCTCATTGACAAACTGCTCAAATCATTTTCATTGAGTTCTTTTTCAGAGCTTAAG
CAGAAACTGCCCTTTCAAGAACTGATTGACTATCTGGCGGAAGAAACCATCGTTCAAAAAATAACGGTGG
AAGAATCCATTATCCAAAACATAAATCTTTACCTGTCTTCCAAGCCAAAGGAGTTCTATTTCGATCGTGA
ATATGGCTGTATTGTGCATAATTATGATTTCAGGCAACTCAACGACACCCCGAGTAAAGACCAGCTGAAA
CGCACGATTTCCGATTACCTGCAAAAATTTGAAAAACGTATCACGGTCAATACCGTCAGTATCGAAATAA
ACGATGTGCAGGAATCAGTGGAAGGAAGCCATCCGCGTATCTGCCGCTACATCACCATCACGATAGCCGG
TATACTTGTCCAAACACAGGAACGGCTCAGGGAGATGAAATTCAGGCTGGTACGCTATACTTAA
 Primer design