SecReT6
Protein ID: 338214589
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5220
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6067201..6069024 [+]
Producthypothetical protein
NoteTssF
UniProt IDF8EIH7
KEGG IDrsi:Runsl_5220
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 607 a.a.     [Download]
>gi|338214589|ref|YP_004658652.1| hypothetical protein [Runella slithyformis DSM 19594]
MYNDPKRYKTREYIRNEMIREVANLWNYDDSDVAIESFDPLVGMLLGAFATSIEGIHHELDNSRSRIIRR
LAHLLTPDVLSGPQAAHAVMKVGIVDTSYTVSPQDIFTCNASGKEFHFTPAGQYTLYNCKLAAQIIQNRV
KTLGSAPRENFLNEILPHNEVWVGINMDSGPEEFDRLPFFFDWRNDPARRSYLPLLGDVRMLTESGEELK
IMPGLVNISPASGTADDFDPTAQAERMTQRFYNAHFLSISNTHRQTGQRIVLQKKKHPEELASLLNPEEL
QKIFLQELVWIKIRFPGGMAPDVLSRIVVDINAFPVLNRRALRPTFDLRPLFNVFPINVEESDFFFGIID
IETPMGIKLSNSRQFTRDSTNQYLLRQGGVARFDERDASEMISYLTDLLRDESAMFMALGRGSLETDIEE
IRKHLERINKDLKKDSFPNWFVSVKTAEKSGRIVLNYWVTKADLANNIAFNTKLNRDRANKAFNDEMTVF
LTTTQGGQRPLQGDEYLPVFRKALLTRGRIVTFEDYKAVCMSELGNQISEVNVKKGFGVGSAQDQGLQQT
VDIYLTPNPLKPQSREQWGELKARLLNSLEDQSSGIFPIRIFVHGEQ
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6067201-6069024 Runella slithyformis DSM 19594 chromosome, complete genome
ATGTACAACGACCCTAAACGCTATAAAACGCGAGAGTATATCCGCAATGAAATGATTCGAGAGGTGGCAA
ACCTGTGGAATTATGACGACAGCGATGTGGCCATTGAAAGCTTCGACCCTTTGGTTGGGATGCTTTTAGG
GGCATTTGCCACAAGTATTGAAGGTATTCATCATGAGTTGGACAACTCCCGGAGCAGGATCATTCGGCGC
TTGGCGCACTTACTCACGCCCGATGTTCTTTCCGGCCCGCAGGCAGCCCACGCAGTCATGAAAGTCGGTA
TCGTGGATACATCGTATACGGTTTCACCGCAGGACATTTTTACCTGCAATGCCTCCGGAAAAGAGTTTCA
TTTTACCCCGGCCGGGCAGTACACATTATACAATTGTAAGCTGGCGGCCCAGATCATTCAGAACCGGGTC
AAGACCCTCGGGTCGGCTCCCCGTGAGAATTTTTTAAACGAGATACTGCCGCATAACGAAGTGTGGGTAG
GGATAAATATGGACAGTGGACCGGAAGAGTTTGACCGTCTACCGTTCTTTTTTGATTGGCGAAATGACCC
CGCCCGACGCTCATACCTTCCCCTTTTGGGTGATGTACGAATGCTTACCGAGTCAGGTGAGGAACTTAAA
ATCATGCCCGGCTTAGTGAATATCAGCCCGGCCTCGGGCACCGCAGATGATTTTGATCCCACCGCGCAGG
CCGAGCGAATGACCCAACGGTTTTACAATGCTCACTTCCTGAGTATCAGCAACACGCATCGCCAAACGGG
GCAGCGCATCGTGCTTCAGAAAAAGAAACACCCTGAGGAACTCGCTTCCCTGTTGAATCCGGAGGAATTA
CAAAAGATTTTCCTACAGGAGCTGGTTTGGATAAAGATCCGATTTCCCGGAGGAATGGCCCCCGATGTCC
TTTCCCGAATCGTTGTAGATATCAACGCTTTTCCCGTCTTAAATCGGAGGGCCCTGCGTCCGACGTTTGA
CCTGCGTCCTTTGTTCAATGTATTTCCGATCAACGTGGAAGAAAGCGATTTCTTTTTCGGAATCATTGAT
ATCGAAACCCCTATGGGCATAAAACTCAGCAACAGCCGGCAATTCACCCGCGACAGCACGAATCAGTACT
TACTGCGTCAGGGAGGAGTAGCGCGTTTTGACGAACGGGACGCCTCGGAAATGATCTCCTACCTGACCGA
TCTGCTGCGCGACGAAAGTGCGATGTTTATGGCACTGGGACGGGGCAGTTTGGAAACTGATATTGAAGAA
ATCAGAAAACACCTCGAGCGAATCAATAAAGATCTGAAAAAAGACAGTTTTCCCAACTGGTTTGTCTCCG
TAAAAACGGCGGAAAAAAGCGGCAGGATCGTCCTGAACTATTGGGTAACGAAGGCCGACCTTGCCAACAA
CATCGCATTTAATACGAAACTGAACCGAGACCGCGCCAACAAGGCTTTTAACGATGAAATGACGGTATTC
CTTACCACTACCCAAGGCGGACAGCGCCCTTTGCAGGGCGATGAGTATCTGCCCGTCTTCAGAAAAGCGC
TCCTGACTCGCGGAAGAATCGTAACCTTTGAAGATTATAAAGCCGTATGCATGAGTGAGTTGGGCAATCA
AATCAGCGAAGTCAACGTAAAGAAAGGCTTCGGTGTAGGCTCTGCCCAAGACCAAGGACTGCAGCAAACC
GTAGATATTTACCTGACGCCCAATCCGCTTAAACCCCAAAGCCGGGAGCAATGGGGCGAACTCAAAGCCC
GGCTGCTGAATAGCCTCGAAGACCAATCCTCAGGGATTTTTCCCATCCGAATCTTTGTACACGGTGAACA
GTAA
 Primer design