SecReT6
Protein ID: 338214590
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5221
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6069037..6070038 [+]
Producthypothetical protein
NoteTssG
UniProt IDF8EIH8
KEGG IDrsi:Runsl_5221
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 0.003, Aligned region: 227..290
Protein Sequence: 333 a.a.     [Download]
>gi|338214590|ref|YP_004658653.1| hypothetical protein [Runella slithyformis DSM 19594]
MNAEELSKIPEQLAVKRLRVEGIVDELVSHGIYPAQKIIIAPERSSSYHYERDISDVYEVHNQYSGSVRC
RLNTPRDGLYESLPERLFHKPSGRIKDNEQWYELRKEERRQEQEARQFLLPFDNALGHQRVRIEQFEKKA
LAGQEKGFLDEFLALFWPDAPQLELSEHQQFVLFQLTVIAHKVAGNIQWTRDCFEQMLNDRVRITYENNP
YTLPVETVFAPLGAAIMGVDSILNSGRYPKGRRLKIQIGPLSYERMSHYFPNQKSERLLHFLCNLLIPVE
LDWTSELLPKVRKDPENEADAIEPGEKTPETLISFHLHNDTQKAVLGYTTVLG
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6069037-6070038 Runella slithyformis DSM 19594 chromosome, complete genome
ATGAACGCTGAAGAGCTCAGTAAAATACCGGAACAATTGGCCGTGAAACGATTACGGGTAGAAGGCATTG
TGGATGAACTCGTCTCTCATGGCATCTATCCGGCCCAAAAAATAATCATTGCCCCGGAACGCTCGTCCTC
TTATCACTATGAACGCGATATCAGTGACGTTTACGAAGTCCACAATCAATATTCGGGCAGTGTCCGGTGC
AGGCTAAACACCCCGCGGGACGGTCTCTATGAGTCGCTTCCCGAAAGGCTTTTTCATAAGCCTTCGGGAA
GGATCAAAGACAATGAGCAGTGGTACGAACTCCGCAAAGAAGAACGCCGGCAGGAACAGGAAGCCCGTCA
ATTTTTATTGCCCTTTGACAATGCCCTCGGTCATCAGCGGGTTCGGATTGAGCAATTTGAAAAAAAGGCA
TTGGCAGGGCAGGAAAAAGGGTTTCTGGACGAATTTTTGGCCCTATTTTGGCCCGATGCCCCCCAGCTTG
AGCTATCGGAACACCAACAGTTCGTACTGTTTCAGCTCACGGTCATTGCCCATAAAGTCGCCGGAAATAT
ACAGTGGACCCGGGATTGCTTTGAACAAATGCTGAATGATCGGGTCCGCATTACGTATGAAAACAACCCG
TATACCCTGCCCGTCGAAACGGTCTTTGCACCGCTGGGAGCAGCCATCATGGGGGTTGATTCTATCCTTA
ACAGCGGCCGGTACCCAAAAGGGAGAAGGTTAAAAATACAGATCGGCCCCCTCTCGTATGAGCGTATGAG
CCATTACTTTCCAAACCAAAAGAGTGAAAGACTGCTGCATTTTCTGTGCAATCTGCTTATTCCCGTTGAG
TTGGATTGGACCTCGGAACTGCTGCCAAAAGTGCGAAAAGACCCCGAAAACGAAGCCGATGCCATCGAGC
CAGGTGAGAAAACACCGGAAACACTGATCTCATTTCATTTACATAACGATACCCAAAAAGCGGTTTTAGG
GTATACCACAGTCTTAGGCTGA
 Primer design