SecReT6
Protein ID: 338214591
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5222
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6070061..6070909 [+]
Producthypothetical protein
NoteTssN
UniProt IDF8EIH9
KEGG IDrsi:Runsl_5222
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 282 a.a.     [Download]
>gi|338214591|ref|YP_004658654.1| hypothetical protein [Runella slithyformis DSM 19594]
MVFSIGTLVIFSSCLAIAVLSTALLYIQEASKINGIRLFLGALGLVLLFGITGVALSKTRSLPVVFAVLS
LLSSVSGIVYTVWGRRFFQWYTRESFASGMMTFIVWGGWAAAGFTTVYGLISPKATVFLADLIVGIVPII
LPYLISKSYDFWLSIPQLKYKKWYYDPQVSLPVLEPINIVRVNMQFTRIPDEPEPVFEGYWVELPGDKEL
GTLFHYFIYSHNNRHREHKKDPIRVDINGKKMGWLLYKQNALGQRMYLNTDLSPVQNNITDNETIFAQSF
SN
 
Nucleotide Sequence: 849 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6070061-6070909 Runella slithyformis DSM 19594 chromosome, complete genome
ATGGTATTTTCTATAGGTACATTGGTCATTTTCAGTAGCTGCCTTGCCATTGCCGTGCTTTCTACAGCGC
TGTTATACATTCAGGAAGCCTCCAAAATAAACGGGATCAGGCTTTTTTTAGGGGCTTTAGGTCTTGTGCT
GCTATTTGGCATAACGGGAGTAGCGCTATCCAAAACGCGCTCACTTCCCGTGGTCTTTGCTGTACTTTCC
CTGCTCTCCTCTGTATCGGGCATTGTTTATACCGTTTGGGGCCGCCGATTTTTCCAATGGTATACCCGGG
AGTCTTTTGCTTCAGGAATGATGACATTTATTGTATGGGGCGGGTGGGCCGCGGCGGGCTTTACAACGGT
ATATGGCCTGATTTCTCCGAAGGCGACCGTATTTTTAGCTGACTTAATCGTGGGGATCGTACCCATTATC
CTGCCTTACCTGATCAGTAAATCCTATGATTTTTGGCTCAGCATCCCCCAACTGAAATACAAAAAATGGT
ATTATGACCCTCAGGTATCTCTGCCCGTATTGGAACCGATCAATATTGTCAGAGTAAACATGCAGTTTAC
CAGAATCCCCGATGAGCCGGAACCTGTATTTGAAGGGTATTGGGTAGAATTGCCCGGCGACAAAGAACTG
GGCACATTGTTTCATTATTTTATTTACTCGCACAACAACCGTCATCGAGAACACAAAAAAGATCCGATCA
GGGTTGATATCAACGGAAAAAAAATGGGGTGGCTGCTGTATAAACAAAATGCGTTGGGTCAACGCATGTA
TTTAAACACCGACCTTTCGCCGGTTCAAAATAACATCACGGACAATGAAACGATCTTCGCACAAAGTTTT
TCAAATTAA
 Primer design