SecReT6
Protein ID: 338214592
SecReT6 ID919
T6SS typeiii
Gene symbol-
Locus tagRunsl_5223
StrainRunella slithyformis DSM 1959
Repliconchromosome [GenBank: NC_015703] [Browse all T6SS(s) in this replicon]
Location [Strand]6070915..6072027 [+]
Producthypothetical protein
NoteTssK
UniProt IDF8EL27
KEGG IDrsi:Runsl_5223
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-07, Aligned region: 60..108
DUF876 [PF05936], Evalue: 1.10E-07, Aligned region: 144..229
DUF876 [PF05936], Evalue: 1.10E-07, Aligned region: 324..341
Protein Sequence: 370 a.a.     [Download]
>gi|338214592|ref|YP_004658655.1| hypothetical protein [Runella slithyformis DSM 19594]
MFLPEIKYNFVNWRDGMKITQKHFTENDFAAKDAIRDIAAIHTTNFSYGLLSADDGMTSALSAPILAGDV
IQITECRGITPGGVRIEWKSLKDHPVLSLSLLDYKFKLGSAGVFYVVIKADPFKTVEVGEYTGDDGLNRR
PYLAVKPTLDLLSMHDMLSDAYSFPICRLRFENQRFSIDHEYIPPSVNIHGEGLLWYYESCGTLLNNIQQ
LAVQIVRKIGGMQNRSSVAVDIHRILEKVLIHCAESMDYYRIVVKELSPVYMAEYFMRLARMFRISFDCL
PETNAAVLFNYFQNTIAGTTGVFKTPVSAASKSLIDSMIDNVLISQYSHNDSTMLFDSIVRFLDFMDFFL
QKLITLNYADNKGSWDIYAK
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|338209545|ref|NC_015703.1|:6070915-6072027 Runella slithyformis DSM 19594 chromosome, complete genome
ATGTTCTTACCTGAAATTAAATACAATTTTGTCAATTGGCGTGATGGAATGAAAATCACGCAAAAGCATT
TTACCGAAAATGACTTTGCCGCGAAGGATGCCATCAGAGATATTGCAGCCATTCATACCACTAATTTCAG
CTATGGACTGCTTTCTGCGGATGACGGTATGACCTCGGCTTTATCAGCGCCGATATTGGCAGGCGACGTG
ATACAGATCACCGAATGCAGGGGTATCACTCCCGGAGGCGTTCGTATTGAATGGAAATCGTTAAAAGACC
ATCCTGTACTCAGTTTATCATTGCTGGATTATAAATTCAAACTTGGCTCAGCCGGGGTATTTTACGTCGT
CATCAAGGCAGACCCTTTCAAAACCGTTGAAGTAGGCGAGTATACCGGTGACGACGGGTTGAACCGACGC
CCGTACCTGGCCGTCAAACCCACCTTGGATTTGCTCTCAATGCATGACATGCTCTCGGATGCGTACAGTT
TTCCGATCTGCCGCCTGCGCTTTGAAAATCAGCGTTTTTCCATTGACCACGAATACATTCCTCCATCGGT
CAATATTCACGGGGAAGGGTTGTTGTGGTATTACGAAAGTTGCGGTACCTTATTGAATAACATTCAGCAG
TTGGCCGTGCAAATCGTCCGAAAAATCGGCGGTATGCAAAACAGAAGCAGCGTTGCGGTAGATATTCACC
GAATTTTGGAAAAAGTACTTATTCACTGTGCCGAATCCATGGATTATTATCGGATCGTGGTCAAAGAACT
GTCGCCCGTGTATATGGCTGAATACTTTATGAGGCTGGCCCGCATGTTTCGGATCTCCTTCGACTGCCTG
CCCGAAACCAACGCTGCGGTCCTTTTTAATTATTTCCAAAATACCATCGCCGGCACTACCGGTGTCTTTA
AAACACCGGTATCGGCCGCCTCAAAGTCGCTCATTGATTCCATGATCGACAACGTACTGATAAGCCAATA
CAGTCATAACGACAGTACGATGCTGTTTGACAGTATCGTACGGTTTTTAGACTTTATGGATTTTTTCTTA
CAGAAACTCATCACGCTCAACTATGCTGATAATAAAGGCAGTTGGGACATTTATGCAAAATAA
 Primer design