SecReT6
Protein ID: 338536021
SecReT6 ID450
T6SS typei1
Gene symbol-
Locus tagLILAB_31980
StrainMyxococcus fulvus HW-1
Repliconchromosome [GenBank: NC_015711] [Browse all T6SS(s) in this replicon]
Location [Strand]7860098..7863790 [+]
Producthypothetical protein
NoteTssM
UniProt IDF8C9J8
KEGG IDmfu:LILAB_31980
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-79, Aligned region: 172..434
ImcF-related_N [PF14331], Evalue: 2.00E-79, Aligned region: 480..491
IcmF-related [PF06761], Evalue: 6.20E-36, Aligned region: 360..417
IcmF-related [PF06761], Evalue: 6.20E-36, Aligned region: 480..803
DUF1215 [PF06744], Evalue: 2.20E-25, Aligned region: 935..1046
AAA_16 [PF13191], Evalue: 0.0014, Aligned region: 112..215
AAA_16 [PF13191], Evalue: 0.0014, Aligned region: 761..761
AAA_17 [PF13207], Evalue: 0.0069, Aligned region: 115..140
AAA_17 [PF13207], Evalue: 0.0069, Aligned region: 316..339
AAA_17 [PF13207], Evalue: 0.0069, Aligned region: 577..577
AAA_17 [PF13207], Evalue: 0.0069, Aligned region: 712..737
Protein Sequence: 1230 a.a.     [Download]
>gi|338536021|ref|YP_004669355.1| unnamed protein product [Myxococcus fulvus HW-1]
MGYLLPLLGIGAPMFALMTYLGFTMQQAAIIAALAGLLAMGVVWLVKRIRARAAAKKLEGALAAQADEQA
TTVRPDLQPEIKAMQGEFTKAVEALKASKLARGGKDALAVLPWYLIVGPPGAGKSTALRNSGLKFPYLSA
RGGVRGVGGTRNCDWWLTNEAVLLDTAGRYTSAEEDRPEWLAFLDTVAKHRPNRPINGLIVAISVSELLN
ADPQAVGEMGQTIRERLDEITTRLKMLVPVYVMITKCDLLPGFVEMFSDLSRVERGQIWGFTVPLEQQRE
ASTDLFRERFDEMLSVLEQRSLRRLGQERRLETREKIYGFPQKFDALRKNLAEFLQPLFLENVFQDTPVF
RGLYFNSGTQELRPVDKVSPSAAEMFGSTNGRAQTDGATDGRSYFLWDVFTKVMFQDQQVAVRSSLEEAR
VRRQRMVLASAAFAATVLLLSLPTVSFFQNRGMAEAVTDAITRVNLDPRDDIRRVEDLIPLRNRLQELTE
YEEGGAPVFMRFGLYQGQKLLPQARQFYNAALRRVLLGKQFELIQQRLDSFGKNPDLLKVRSDEDYSKHF
DAYRQYFDDLKMYLLVTTPRDPREPELDETQRKWLQDEIVKHWKRVRGDSVDERAVANHAETFLLMLANE
QMLPEEHKPAREQRIAFSRVTGVVQSARRSLNNVPLVRLELAQLVANMSGAYPDVTLEQLVGSVPQMSAE
SRVRGAFTRKAYDDVIRERLELAFQDQQSWVLDRDEKVDTASSRRELRTRYFEAYTQEWKDFLGSIRVQA
PENLTQMESLLTNLTRGKPKPYGRLFRALTYNVVLDKRDTKAAEAETGLLARAGKLFGSEPEKEAAKKRE
LLNANSPSGAQEVTARDVEREFASLIRFATETSKTEDGEESLTALDSYEDQLATVQTTLLAVKDKPAESG
LLLDKIETTRNNVELMVRKQTDNVAIFERLLLPPFQEMRSVVFVGVACNKSKLWNDQVVLAWNHAFKGKY
PFDRASQADAPLPEVAEFLRPEGGLVRKFVKEQLLEDVVATGRRWEFTSSGGVMYRPDMLNFLEKTGALS
TTLFPGGDTVDPLVRFQVRLRPGVSADGMASQISSITLTLDGTDETYRNGPDTVWKPMIWPGQAGKLGAR
ITVQSADGSTETSLEAEGDWGLFRLLERVKRIEPSADGRYFTATWEIEEMNGALVSIDFRPERTANPFFG
MSGNTSKLLAIFRDPGLQPPVSIARKGECASQAVAADGVR
 
Nucleotide Sequence: 3693 bp     [Download]
>gi|338529680|ref|NC_015711.1|:7860098-7863790 Myxococcus fulvus HW-1 chromosome, complete genome
ATGGGGTACCTGCTACCGCTGCTCGGCATCGGCGCGCCGATGTTCGCCCTGATGACGTACCTGGGTTTCA
CCATGCAGCAGGCGGCCATCATCGCCGCGCTCGCGGGCCTGCTGGCCATGGGCGTGGTGTGGCTGGTCAA
GCGCATCCGCGCGCGCGCCGCCGCCAAGAAGCTGGAGGGCGCGCTGGCGGCGCAGGCGGATGAGCAGGCC
ACCACCGTGCGGCCGGACCTGCAGCCTGAAATCAAGGCCATGCAGGGGGAGTTCACCAAGGCGGTGGAGG
CCCTCAAGGCCTCCAAGCTGGCGCGCGGCGGCAAGGACGCGCTGGCGGTGCTGCCCTGGTACCTCATCGT
CGGGCCGCCGGGCGCCGGCAAGAGCACCGCGCTGCGCAACTCCGGGCTGAAGTTCCCCTACCTCTCCGCG
CGCGGCGGCGTGCGCGGCGTGGGCGGCACGCGCAACTGCGACTGGTGGCTGACCAACGAGGCCGTGCTGC
TGGACACCGCGGGCCGCTACACCAGCGCGGAGGAGGACCGGCCGGAGTGGCTGGCCTTCCTGGACACGGT
GGCCAAGCACCGCCCCAACCGGCCCATCAACGGGCTCATCGTGGCCATCAGCGTCAGCGAGCTCTTGAAC
GCGGACCCGCAGGCCGTGGGGGAGATGGGGCAGACCATCCGCGAGCGCCTGGATGAAATCACCACCCGGC
TGAAGATGCTGGTGCCGGTGTACGTGATGATCACCAAGTGCGACCTGCTGCCCGGCTTCGTGGAGATGTT
CTCGGATTTGTCGCGCGTGGAGCGCGGGCAGATCTGGGGCTTCACGGTGCCGCTGGAGCAGCAGCGCGAG
GCGAGCACGGACCTGTTCCGCGAGCGCTTCGACGAGATGCTCTCCGTGCTGGAGCAGCGCTCGCTGCGCC
GGCTGGGCCAGGAGCGCCGGCTGGAGACGCGCGAGAAGATCTACGGCTTCCCGCAGAAGTTCGACGCGCT
CCGGAAGAACCTGGCGGAGTTCCTCCAGCCGCTCTTCCTGGAGAACGTGTTCCAGGACACGCCCGTCTTC
CGCGGCCTGTACTTCAACAGCGGCACGCAGGAGCTGCGCCCGGTGGACAAGGTGTCCCCGTCCGCGGCGG
AGATGTTCGGCAGCACCAACGGCCGGGCGCAGACGGACGGCGCCACGGACGGCCGCAGCTACTTCCTCTG
GGACGTCTTCACCAAGGTGATGTTCCAGGACCAGCAGGTGGCGGTGCGCAGCTCGCTGGAGGAGGCGCGG
GTGCGCCGCCAGCGGATGGTCCTGGCCAGCGCGGCCTTCGCGGCCACGGTGCTGCTGCTGTCGCTGCCCA
CGGTGTCCTTCTTCCAGAACCGCGGCATGGCGGAGGCCGTCACCGACGCCATCACCCGCGTGAACCTGGA
CCCGCGCGACGACATCCGCCGCGTCGAGGACCTGATTCCCCTGCGCAACCGGCTCCAGGAGCTGACCGAG
TACGAGGAGGGCGGCGCGCCGGTGTTCATGCGCTTCGGCCTCTATCAGGGCCAGAAGCTGCTGCCGCAGG
CGCGCCAGTTCTACAACGCGGCCCTGCGCCGGGTGCTGCTCGGCAAGCAGTTCGAGCTCATCCAGCAGCG
GCTGGACAGCTTCGGGAAGAACCCGGACCTGCTGAAGGTGCGCAGCGACGAGGACTACAGCAAGCACTTC
GACGCGTACCGGCAGTACTTCGACGACCTGAAGATGTACCTGCTGGTGACGACGCCCCGCGACCCGCGCG
AGCCGGAGCTGGACGAGACGCAGCGCAAGTGGCTCCAGGACGAAATCGTCAAGCACTGGAAGCGCGTGCG
GGGTGACTCGGTGGACGAGCGCGCCGTGGCGAACCACGCGGAGACCTTCCTGCTGATGCTCGCCAACGAG
CAGATGCTCCCGGAGGAGCACAAGCCGGCGCGTGAGCAGCGCATCGCCTTCAGCCGCGTCACCGGCGTGG
TGCAGTCGGCGCGCCGCTCGCTCAACAACGTGCCCCTGGTGCGGCTGGAGCTGGCGCAGCTCGTGGCCAA
CATGAGCGGCGCGTACCCGGACGTGACGCTGGAGCAGCTCGTGGGCTCGGTGCCGCAGATGAGCGCCGAG
TCCCGGGTGCGGGGCGCCTTCACGCGCAAGGCCTACGACGACGTCATCCGCGAGCGGCTGGAGCTGGCCT
TCCAGGACCAGCAGTCCTGGGTGCTGGACCGCGACGAGAAGGTGGACACGGCGAGCTCGCGCCGCGAGCT
GCGCACGCGCTACTTCGAGGCGTACACCCAGGAGTGGAAGGACTTCCTCGGCTCCATCCGCGTGCAGGCC
CCGGAGAACCTGACGCAGATGGAGAGCCTGCTGACGAACCTGACGCGCGGCAAGCCCAAGCCCTACGGGC
GGCTGTTCCGCGCGCTCACCTACAACGTGGTGCTGGACAAGCGCGACACGAAGGCCGCGGAGGCGGAGAC
GGGCCTCCTGGCCAGGGCGGGGAAGCTGTTCGGCTCGGAGCCGGAGAAGGAGGCGGCGAAGAAGCGCGAG
CTGCTCAACGCCAACTCTCCGTCGGGCGCCCAGGAGGTCACCGCGCGCGACGTGGAGCGCGAGTTCGCCT
CGCTCATCCGCTTCGCCACGGAGACGTCCAAGACGGAGGACGGCGAGGAGTCCCTGACGGCGCTGGACTC
ATACGAGGACCAGCTCGCCACCGTCCAGACGACGCTGCTGGCGGTGAAGGACAAGCCGGCCGAGTCCGGC
CTGCTGCTGGACAAGATCGAGACCACCCGCAACAACGTGGAGCTGATGGTCCGCAAGCAGACGGACAACG
TCGCCATCTTCGAGCGGCTGCTGCTGCCCCCGTTCCAGGAGATGCGCTCGGTGGTGTTCGTGGGCGTGGC
CTGCAACAAGAGCAAGCTGTGGAACGACCAGGTGGTGCTGGCGTGGAACCACGCCTTCAAGGGGAAGTAC
CCGTTCGACCGCGCGTCGCAGGCGGACGCGCCCCTGCCGGAGGTGGCGGAGTTCCTCCGGCCCGAGGGCG
GCCTGGTGCGCAAGTTCGTCAAGGAGCAGCTCCTGGAGGACGTGGTGGCCACCGGGCGCCGGTGGGAGTT
CACCTCGTCGGGCGGCGTCATGTACCGGCCCGACATGCTCAACTTCCTGGAGAAGACGGGCGCGCTGTCC
ACCACCCTCTTCCCCGGCGGCGACACGGTGGACCCGCTGGTCCGCTTCCAGGTGCGCCTGCGCCCGGGCG
TCTCGGCGGACGGGATGGCGTCGCAGATTTCGTCCATCACCCTGACGCTCGACGGCACGGACGAGACGTA
CCGCAACGGCCCGGACACCGTGTGGAAGCCGATGATCTGGCCCGGCCAGGCCGGCAAGCTCGGCGCCCGC
ATCACCGTGCAGAGCGCGGATGGCTCCACGGAGACGTCGCTGGAGGCCGAGGGTGACTGGGGGCTGTTCC
GCCTGCTGGAGCGCGTCAAGCGCATCGAGCCCAGCGCCGACGGCCGCTACTTCACGGCGACGTGGGAGAT
CGAGGAGATGAACGGCGCGCTGGTCTCCATCGACTTCCGCCCGGAGCGCACCGCGAACCCCTTCTTCGGG
ATGTCGGGCAACACGTCCAAGCTGCTGGCCATCTTCCGGGACCCGGGGTTGCAGCCGCCGGTGAGCATCG
CGCGGAAGGGTGAGTGCGCGTCGCAGGCCGTCGCGGCGGATGGGGTTCGTTGA
 Primer design