SecReT6
Protein ID: 339487731
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2828
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3143375..3145231 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF8FXL5
KEGG IDppt:PPS_2828
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-80, Aligned region: 38..347
Phage_base_V [PF04717], Evalue: 9.50E-24, Aligned region: 381..474
Phage_base_V [PF04717], Evalue: 9.50E-24, Aligned region: 542..584
Gp5_C [PF06715], Evalue: 2.10E-06, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 2.10E-06, Aligned region: 552..565
DUF2345 [PF10106], Evalue: 0.00047, Aligned region: 562..612
Protein Sequence: 618 a.a.     [Download]
>gi|339487731|ref|YP_004702259.1| unnamed protein product [Pseudomonas putida S16]
MIMDLASALLSPQNRRLFKFHNLANPEQELLLETFKGTEALSRAFNYELLLVCEDSGVPLKSMMGQHVSI
EIELAEGGPRYITGYLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAF
SRHEFRLTRPQKRYTYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVDIPEQPQIRF
HSASVTETADSITQWSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNKQGDVENFEIYDFPGQYTHGTY
DEGETLLRLRIEALELRGKKFEGASNCRAMKPGYTFELLQHYIHDQGPVEDRQFLLMSVESEGHNNYLTG
QQASYFNTFSCVRKKIPFRPQLSTPKPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRNGKYNDHSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMK
GDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRTITVGGTHTETVKKDTMVQVTEGSYT
LQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIVTTSTDTTQITGAAVRIND
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|339484941|ref|NC_015733.1|:c3145231-3143375 Pseudomonas putida S16 chromosome, complete genome
ATGATCATGGACCTGGCCTCCGCGCTGCTGTCGCCGCAGAACCGCCGCCTGTTCAAGTTTCACAACCTGG
CCAACCCCGAGCAGGAACTGCTGCTGGAAACCTTCAAGGGCACCGAAGCCCTGTCGCGGGCGTTCAACTA
CGAACTGCTGCTGGTCTGCGAAGACTCCGGCGTGCCGCTCAAATCCATGATGGGCCAGCATGTCAGCATC
GAGATCGAACTGGCCGAAGGCGGCCCGCGCTACATAACCGGCTACCTCACACGCTTTGCCAGCATTGGCA
GCGACGGCGGCATGGCACGCTATACCGCAACCCTCAACCCGTGGTTCTCGATGTTGAAGAACCGCTTCGA
CACGCGGATCTTCCAGGGCAACACGGTCGAGGAAGTGGTTACCGAAGTGTTCGCCCTGTGCCCGGCGTTC
TCTCGTCACGAGTTCCGCCTGACCCGTCCGCAGAAGCGCTACACCTACATCACCCAGTACCGTGAAACCG
ACTTCAACTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGTTCTACTACTTCGAGCACACCGCCGAAGG
CCACACCATGATCATCTGCGATGACTCCAGCACGCTGGTGGACATCCCCGAGCAACCGCAAATCCGCTTC
CACAGCGCCTCGGTCACCGAGACTGCCGACTCCATCACCCAGTGGAGCGGCAACCGCCAGTTGCAGTCCG
GCAAGATGGCCACGCAGACCTTCGACTACCGCCAGCCCAACAACCGCCTGCCGGTGGCGCTGAACAGCGT
GAACAAGCAGGGCGATGTCGAGAACTTCGAGATCTACGACTTCCCCGGCCAGTACACCCACGGCACCTAC
GACGAGGGCGAAACCCTGCTGCGCCTGCGCATCGAGGCGCTGGAGCTACGCGGCAAGAAATTCGAAGGTG
CCAGTAACTGTCGGGCCATGAAGCCGGGCTACACCTTCGAGCTGCTGCAGCACTACATCCACGACCAGGG
CCCGGTAGAAGACCGCCAGTTCCTGCTGATGAGCGTGGAAAGCGAAGGCCACAACAACTACCTTACCGGC
CAGCAGGCCAGCTACTTCAACACCTTCAGTTGCGTGCGCAAGAAGATCCCGTTCCGCCCGCAGCTGAGCA
CGCCCAAGCCGACCATCGCCGGCCCGCAGACCGCGATCATCGTCGGCCCACCGGGTGAGGAAATCTTCAC
CGACGAACTGGGCCGGGTGAAGATCCAGTTCCACTGGGACCGCAATGGCAAGTACAACGACCACAGCTCC
TGCTGGGTCCGCGTCGCCCAATCCGGTGCCAGCGGCGGCTTCGGCAGCATCCAGATCCCACGTGTAGGCG
ACGAAGTGGTGGTGGTGTTCCTCGACGGCAACCCCGACCGGCCGCTGATCATGGGCAGCCTGTACAACAG
CACCAACACCCCGCCATGGTCGCTGCCGGCGAACAAGACCCAGAGTGGTTTCCTGACCCGGTCGATGAAG
GGCGACGGCGGTACCGCCAACTTCTTCCGCTTCGAGGACAAGGCTGGCGCCGAGCAGATCATCATGCATG
CCGAGCGCAACATGGATACCGAGATCGAGTTGGATGAGACCCATGATGTGGGGAACAACCGCACGATTAC
GGTGGGCGGCACGCACACCGAAACGGTCAAGAAAGACACCATGGTGCAAGTGACCGAAGGTTCCTACACC
CTGCAGGTCGACAACCAGTTCATACAGGTGGCTGCCAAGCAGCACATCATCCTGCAGGTGGGCGACAGCA
GCATCACGCTGACCCCGGAAGGCATCGAGATCAAAGGCAAGGTCATCGTGACCACCAGCACCGACACCAC
CCAGATCACTGGCGCTGCAGTGCGGATCAACGACTGA
 Primer design