SecReT6
Protein ID: 339487739
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2836
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3153504..3154079 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDF8FXM3
KEGG IDppt:PPS_2836
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-60, Aligned region: 3..25
DUF770 [PF05591], Evalue: 1.20E-60, Aligned region: 23..177
Protein Sequence: 191 a.a.     [Download]
>gi|339487739|ref|YP_004702267.1| unnamed protein product [Pseudomonas putida S16]
MFRSELLALENTMAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLK
DRKFVYIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRN
KLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSSDRA
 
Nucleotide Sequence: 576 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3153504-3154079 Pseudomonas putida S16 chromosome, complete genome
TTGTTTCGCAGCGAATTGCTCGCACTGGAGAACACGATGGCGAAGAAGGAAAGCACTCAGCACAAACTCG
ACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACGACGTGGACATCGGCGATGCCATCGAGAAAAAGGA
GCTGCCCTTCGTCGTCGGCGTACTGGGCGACTTTTCCGGCAACCCGCTGGAGCCGCTGCCCAAACTCAAG
GACCGCAAGTTCGTCTACATCGACCGCGACAACTTCAACGGCGTGCTCAAGGGCATCAAGCCGCGCCTGA
CCTACCGCGTCGACAACACCCTGGCCAAGAACGGCACCCAGCTGGGCGTGGAACTGAACTTCAACAGCCT
CGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGTCGAACCGCTGCGCAAACTGCTGGAAGTGCGCAAC
AAGCTGGCCGACCTGCGTAACAAGATGGGCGGCAACGACAAGCTCGAAGAGCTGCTGATGGACGTGCTGC
AGAACACCGAGAAGCTCAAGACCCTGGGCAAGGAATTCGGCCGTGAAGCCGAAGTGAAAGACCCATCCAG
CAGCGATCGCGCCTGA
 Primer design