SecReT6
Protein ID: 339487740
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2837
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3154094..3155596 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDF8FXM4
KEGG IDppt:PPS_2837
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-197, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|339487740|ref|YP_004702268.1| unnamed protein product [Pseudomonas putida S16]
MTDKQTAPQQAGDLVEVENFAPQASLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASPELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3154094-3155596 Pseudomonas putida S16 chromosome, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCGCCACAGG
CATCGTTGCTCGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGCGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGTATCGCCGAAATCGACGCGATGCTTTCCGAGCAGATGAACGAAATCATGCACGCCC
GTGAGTTCCAGCAGCTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTAGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTACGCGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCACTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGCGCGCCTTTCG
GCATGCTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTGGAGGAGATCTCGCA
CGTCGCCGCGGCCGCCCATGCCCCGTTCATTTCGGCCGCCTCCCCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAAATGTCCGGCCCGCGTGACCTGGCAAAGATCTTCGACACCGTCGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCGCGCTACGTCGGTCTCACCCTGCCGCACGTGCTCGGTCGCCTGCCGTATGG
CCCCGATACCACCCCGGTGGAGGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCTGCCTACGCCCTCGGCACCCGCGTTACCGATGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGTGGCGGCCTGGTCGAAGGTTTGCCAACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCTCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAGCAGAAGCAGTACAACACTGACATTGCCAACGCCAACGCGCGCCTGTCGGCCCAGCTGCAGTACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCCATCATGCGCGACAAGATCGGCAGCTTCGCCTCG
CGCATGGATGTCGAGCGCTTCCTCAACCAATGGCTGGCCAGCTACGTGCTGCTCGACGACACCGCCAGCC
AGGAAGCCAAGGCCAAGTTCCCGCTGCGCGAAGCCCGCGCCGAGGTGTTCGAAGTGCCGGGCAAGCCAGG
TGTGTACAAGGCCGTGACCTACCTGCGCCCGCACTACCAACTGGATGAGCTGACCGCTTCGCTGCGCCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA
 Primer design