SecReT6
Protein ID: 339487741
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2838
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3155623..3156105 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF8FXM5
KEGG IDppt:PPS_2838
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|339487741|ref|YP_004702269.1| unnamed protein product [Pseudomonas putida S16]
MSNQARLLPSLLDRLLDDRPYQSAEPAVQRTCSLSEYKASIVRDLEVLVNTRQSLVAEELEGYSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3155623-3156105 Pseudomonas putida S16 chromosome, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCGTACCAGTCGG
CCGAGCCAGCCGTGCAACGCACCTGCTCGTTGAGCGAGTACAAGGCCAGCATCGTCCGTGACCTGGAGGT
ACTGGTGAACACTCGCCAGAGCCTGGTCGCCGAAGAGCTGGAGGGCTACAGCCAGCTCGGTGGTTCCATC
CTCGAATACGGCATGCCCGACTTCATCAGCCGCAGCGTGCTCGACCCGCATGATCGGCGCCTGATCCAGC
AGCAACTGGAACGGGCGATCAGCACAGGGGACCGACGTTTTCGCCGTGTCCGCGTGCAGCTGCTGGCCCA
GCAGAACGGCCACCGTATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA
 Primer design