SecReT6
Protein ID: 339487742
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2839
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3156105..3157925 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDF8FXM6
KEGG IDppt:PPS_2839
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-211, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|339487742|ref|YP_004702270.1| unnamed protein product [Pseudomonas putida S16]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGKHEKVTEAYRVARHTEMHANAVEGVVCKFRTCYPVELWPIAV
QQASFAELERSAFNGHSADLVARLRIRLAATGDALFGQMELDRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFQDQGRSREVALPADALKAVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLNGFARILQGKA
IEQVEINFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCHPFFEPRGEQDPHSSFWVARRRIQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHMSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVY
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3156105-3157925 Pseudomonas putida S16 chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAAATCGCTTCGCGGCTGTTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCACACTACCTGCGCCCTACCCCATCGATGTCGATTGCCG
AGCTGAGCCTGGGCAAGCACGAGAAAGTCACCGAAGCCTACCGGGTGGCGCGCCATACCGAAATGCATGC
CAATGCCGTGGAAGGTGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTTGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCGCCGAACTGGAGCGTTCGGCCTTCAACGGCCACAGCGCCGACCTGGTCGCACGCC
TGCGCATCCGCCTGGCAGCCACCGGCGATGCCCTGTTCGGGCAGATGGAGCTGGACCGCCTGCGGTTCTT
CCTCGACGGCGAGGCGACCCTGATGCTGCAGCTGTACGAACTGCTGTTCAACAACCTGGCAAAGGCCACC
CTTAGCTTCCAGGACCAGGGCCGCAGCCGCGAAGTGGCCTTGCCGGCCGATGCCCTGAAAGCCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCGTTCCTGGGCTACCGCCTGCTGCACGAGTA
CTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTGAACGGCTTTGCCCGCATTCTGCAGGGCAAGGCC
ATCGAGCAGGTCGAGATCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACAC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACACCGATCATCAACCTGTTCCGCCAGCAAGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCACTCCCGATACACGGCTGCACAACGCTGCC
GAAGTCGTCTCGATCGACCGCGTACGGCGGGTGCGCAAACTCGGCGGCATCGACCAGGTCGCCACCTGCC
ACCCGTTTTTCGAACCCCGTGGCGAGCAGGACCCGCACAGCAGCTTCTGGGTGGCGCGCCGGCGCATCCA
GGGTGACGCCACCGCCATGAGCATCCGCGTGGTCGACCGCGACCTGGAGCTGATCGACGCCAGCAGCGAC
ACCCTCAGCATCGGCCTTACCTGCAGCAACCGCGATGTACCGCTGATGCTGCCGTTCGGGGGCGAACGTG
GTGACTTCAACATTCCCGCCAACTCGGTGATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGTGTGCCCCTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCATATGTCGCTG
GTCAGCCAGGGCCGTGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAGCCGGTGGTCGCACGCATCGGCCACCCGCGGCC
GAACTTCGTACGTGGCGTCGGCATCACGCTGACCCTGGATGAAAGCCAGTTCATCGGCAGTGGCGTGTAC
CTGTTCGGCATGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTCCAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A
 Primer design